KEGG   Homo sapiens (human): 10101Help
Entry
10101             CDS       T01001                                 

Gene name
NUBP2, CFD1, CIAO6, NBP_2, NUBP1
Definition
(RefSeq) nucleotide binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ParA CbiA MipZ AAA_31 ArsA_ATPase MeaB AAA_26 Fer4_NifH CBP_BcsQ APS_kinase AAA_25 SRP54 NB-ARC CLP1_P Zeta_toxin AAA_16 KTI12 AAA_30 AAA_18 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 10101
NCBI-ProteinID: NP_036357
OMIM: 610779
HGNC: 8042
Ensembl: ENSG00000095906
Vega: OTTHUMG00000128639
Pharos: Q9Y5Y2(Tbio)
UniProt: Q9Y5Y2 B7Z6P0
Position
16p13.3
AA seq 271 aa AA seqDB search
MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPR
MLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSD
VAWGELDYLVVDTPPGTSDEHMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKT
GLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGH
DFIQEFPGSPAFAALTSIAQKILDATPACLP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggccgagcctggaaacctggccggcgtcaggcacatcatcctggtcctc
tcaggaaaggggggcgttgggaaaagcaccatctccacggagctggccctggcactgcgc
catgcaggcaagaaggtgggaatcctggatgtggacctgtgtggccccagtatcccccgc
atgctcggggcgcagggcagggctgtgcaccagtgcgaccgcggctgggcacccgtcttc
ctggaccgggagcagagcatctcgctcatgtctgtgggcttcctgctggagaagccggac
gaggccgtggtgtggagaggccccaagaaaaacgcgctgataaagcagtttgtgtccgac
gtggcctggggggagctggactacctggtggtggacacgcccccggggacctccgatgag
cacatggccaccatagaagccctgcgtccctaccagcccctgggggccctcgtggtcacc
acgccccaggcggtgtccgtgggggacgtgaggcgcgagctgaccttctgtaggaagacg
ggcttgcgggtgatgggaatcgtggagaatatgagcggcttcacctgcccacactgcacg
gagtgcaccagcgtcttctccaggggcggcggagaggagctggcccagctcgccggggtg
cccttcttaggctccgtgcccctggaccctgcgctcatgaggaccctggaggagggccac
gacttcatccaggagttccctgggagccccgccttcgctgcactcacctccatagcccag
aagattctggacgcgacgcccgcgtgcctcccctga

DBGET integrated database retrieval system