KEGG   Homo sapiens (human): 10105
Entry
10105             CDS       T01001                                 

Gene name
PPIF, CYP3, CyP-M, Cyp-D, CypD
Definition
(RefSeq) peptidylprolyl isomerase F
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    10105 (PPIF)
   04022 cGMP-PKG signaling pathway
    10105 (PPIF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10105 (PPIF)
   05012 Parkinson disease
    10105 (PPIF)
   05016 Huntington disease
    10105 (PPIF)
   05017 Spinocerebellar ataxia
    10105 (PPIF)
   05020 Prion disease
    10105 (PPIF)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    10105 (PPIF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10105 (PPIF)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     10105 (PPIF)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    10105 (PPIF)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 10105
NCBI-ProteinID: NP_005720
OMIM: 604486
HGNC: 9259
Ensembl: ENSG00000108179
Vega: OTTHUMG00000018562
Pharos: P30405(Tchem)
UniProt: P30405 A0A024QZS4
Structure
PDB: 

Position
10q22.3
AA seq 207 aa
MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGRTSKKIVITDCGQLS
NT seq 624 nt   +upstreamnt  +downstreamnt
atgctggcgctgcgctgcggctcccgctggctcggcctgctctccgtcccgcgctccgtg
ccgctgcgcctccccgcggcccgcgcctgcagcaagggctccggcgacccgtcctcttcc
tcctcctccgggaacccgctcgtgtacctggacgtggacgccaacgggaagccgctcggc
cgcgtggtgctggagctgaaggcagatgtcgtcccaaagacagctgagaacttcagagcc
ctgtgcactggtgagaagggcttcggctacaaaggctccaccttccacagggtgatccct
tccttcatgtgccaggcgggcgacttcaccaaccacaatggcacaggcgggaagtccatc
tacggaagccgctttcctgacgagaactttacactgaagcacgtggggccaggtgtcctg
tccatggctaatgctggtcctaacaccaacggctcccagttcttcatctgcaccataaag
acagactggttggatggcaagcatgttgtgttcggtcacgtcaaagagggcatggacgtc
gtgaagaaaatagaatctttcggctctaagagtgggaggacatccaagaagattgtcatc
acagactgtggccagttgagctaa

DBGET integrated database retrieval system