KEGG   Homo sapiens (human): 101060211Help
Entry
101060211         CDS       T01001                                 

Gene name
CT45A7, CT45-5, CT45-6, CT45A5, CT45A6
Definition
(RefSeq) cancer/testis antigen family 45 member A7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-GeneID: 101060211
NCBI-ProteinID: NP_001278472
HGNC: 51260
Ensembl: ENSG00000273696
Vega: OTTHUMG00000022491
UniProt: P0DMU8 P0DMU7 P0DMV0
Position
Xq26.3
AA seq 189 aa AA seqDB search
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaacagagaaggtggctgtagatcctgaaactgtgtttaaacgtcccagg
gaatgtgacagtccttcgtatcagaaaaggcagaggatggccctgttggcaaggaaacaa
ggagcaggagacagccttattgcaggctctgccatgtccaaagaaaagaagcttatgaca
ggacatgctattccacccagccaattggattctcagattgatgacttcactggtttcagc
aaagatgggatgatgcagaaacctggtagcaatgcacctgtgggaggaaacgttaccagc
agtttctctggagatgacctagaatgcagagaaacagcctcctctcccaaaagccaacga
gaaattaatgctgatataaaacgtaaattagtgaaggaactccgatgcgttggacaaaaa
tatgaaaaaatcttcgaaatgcttgaaggagtgcaaggacctactgcagtcaggaagcga
ttttttgaatccatcatcaaggaagcagcaagatgtatgagacgagactttgttaagcac
cttaagaagaaactgaaacgtatgatttga

DBGET integrated database retrieval system