KEGG   Homo sapiens (human): 101060233
Entry
101060233         CDS       T01001                                 

Symbol
OPN1MW3, GCP, GOP, OPN1MW, OPN1MW2
Name
(RefSeq) opsin 1, medium wave sensitive 3
  KO
K04251  long/medium wavelength-sensitive opsin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    101060233 (OPN1MW3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    101060233 (OPN1MW3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srsx 7TM_GPCR_Srv Cytochrom_B_N_2
Other DBs
NCBI-GeneID: 101060233
NCBI-ProteinID: NP_001316996
HGNC: 51831
Ensembl: ENSG00000269433
Vega: OTTHUMG00000189499
UniProt: P0DN77 P0DN78 P04001
Position
Xq28
AA seq 364 aa
MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWM
IFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFV
LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWA
AVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYL
QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFH
PLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLFGKKVDDGSELSSASKTEVSSVSS
VSPA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcccagcagtggagcctccaaaggctcgcaggccgccatccgcaggacagctatgag
gacagcacccagtccagcatcttcacctacaccaacagcaactccaccagaggccccttc
gaaggcccgaattaccacatcgctcccagatgggtgtaccacctcaccagtgtctggatg
atctttgtggtcattgcatccgtcttcacaaatgggcttgtgctggcggccaccatgaag
ttcaagaagctgcgccacccgctgaactggatcctggtgaacctggcggtcgctgacctg
gcagagaccgtcatcgccagcactatcagcgttgtgaaccaggtctatggctacttcgtg
ctgggccaccctatgtgtgtcctggagggctacaccgtctccctgtgtgggatcacaggt
ctctggtctctggccatcatttcctgggagagatggatggtggtctgcaagccctttggc
aatgtgagatttgatgccaagctggccatcgtgggcattgccttctcctggatctgggct
gctgtgtggacagccccgcccatctttggttggagcaggtactggccccacggcctgaag
acttcatgcggcccagacgtgttcagcggcagctcgtaccccggggtgcagtcttacatg
attgtcctcatggtcacctgctgcatcaccccactcagcatcatcgtgctctgctacctc
caagtgtggctggccatccgagcggtggcaaagcagcagaaagagtctgaatccacccag
aaggcagagaaggaagtgacgcgcatggtggtggtgatggtcctggcattctgcttctgc
tggggaccctacgccttcttcgcatgctttgctgctgccaaccctggctaccccttccac
cctttgatggctgccctgccggccttctttgccaaaagtgccactatctacaaccccgtt
atctatgtctttatgaaccggcagtttcgaaactgcatcttgcagcttttcgggaagaag
gttgacgatggctctgaactctccagcgcctccaaaacggaggtctcatctgtgtcctcg
gtatcgcctgcatga

DBGET integrated database retrieval system