hsa:101060521 : No such data.

KEGG   Homo sapiens (human): 10621Help
Entry
10621             CDS       T01001                                 

Gene name
POLR3F, RPC39, RPC6
Definition
(RefSeq) RNA polymerase III subunit F
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10621 (POLR3F)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10621 (POLR3F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10621 (POLR3F)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10621 (POLR3F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Motif
Other DBs
NCBI-GeneID: 10621
NCBI-ProteinID: NP_006457
OMIM: 617455
HGNC: 15763
Ensembl: ENSG00000132664
Vega: OTTHUMG00000031971
Pharos: Q9H1D9(Tdark)
UniProt: Q9H1D9
Structure
PDB: 

Position
20p11.23
AA seq 316 aa AA seqDB search
MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSM
GQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPL
TEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVL
NQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDIETILN
TLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGG
EISPSNCIYMTEWLEF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgaaggtgaaggtgcagccgcctgacgcggatccggtcgaaatagaaaac
aggattatagaattatgtcaccagttccctcatggaatcacagaccaagtaattcagaat
gaaatgcctcatatagaagcccagcagcgggcagtagccatcaataggttgttgtctatg
ggtcagttggatctcttaaggagcaatacgggccttttatatagaataaaggactctcag
aatgctggtaaaatgaagggatccgataaccaagaaaaactagtatatcaaatcatagag
gatgcaggaaataaaggaatatggagcagagatatccgctataaaagtaatttgccatta
acagaaatcaacaaaattctgaagaatctggaaagtaaaaagcttatcaaagctgttaag
tctgtagcagcctcaaaaaagaaggtgtatatgctctataacctgcagccagaccggtct
gtgactggtggagcctggtacagtgaccaggattttgaatctgaatttgtagaggtgctt
aaccaacagtgttttaaattcctacagtccaaggcagaaacagcacgagaaagcaaacag
aacccaatgatacaaagaaatagttcatttgcctcatcacatgaagtgtggaaatatatc
tgcgaattgggaatcagtaaggtagagttatccatggaagacattgaaaccatcctgaat
acactcatttatgatggaaaagtggagatgacgattattgctgcaaaagaaggcacagtt
ggcagtgtagatggacacatgaaactgtacagggcagtcaatccaatcatccctcccaca
ggtttggtccgggcaccctgtggactctgcccggtttttgatgactgccacgaaggtggt
gagatttcaccatctaactgtatttacatgacagagtggctcgaattttaa

KEGG   Homo sapiens (human): 10622Help
Entry
10622             CDS       T01001                                 

Gene name
POLR3G, RPC32, RPC7
Definition
(RefSeq) RNA polymerase III subunit G
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10622 (POLR3G)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10622 (POLR3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10622 (POLR3G)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10622 (POLR3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_3_Rpc31 SAPS DUF4820 BUD22 Vfa1
Motif
Other DBs
NCBI-GeneID: 10622
NCBI-ProteinID: NP_006458
OMIM: 617456
HGNC: 30075
Ensembl: ENSG00000113356
Vega: OTTHUMG00000162809
Pharos: O15318(Tbio)
UniProt: O15318 A0A024RAM1
Position
5q14.3
AA seq 223 aa AA seqDB search
MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLAL
KQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAG
PKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDD
DAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaataaaggaagaggacgtgctgcttatacctttaatattgaggctgttgga
tttagcaaaggtgaaaagttacctgatgtagtgttgaaaccacccccactatttcctgat
acagattataaaccagtgccactgaaaacaggagaaggtgaagaatatatgctggctttg
aaacaggagttgagagaaacaatgaaaagaatgccttattttattgaaacacctgaagaa
agacaagatattgaaaggtatagtaaaagatacatgaaggtatacaaggaagaatggata
ccagattggagaagacttccaagagagatgatgccaagaaataaatgtaaaaaagcaggc
ccaaaacccaaaaaggcaaaagacgcaggcaaaggcacaccactcactaatactgaagat
gtgttgaaaaaaatggaggaattggaaaaaagaggtgatggtgaaaaatcagatgaggaa
aatgaagagaaagaaggaagcaaagagaaaagtaaagaaggtgatgatgacgatgacgat
gatgccgcagaacaggaggaatatgatgaagaagagcaagaagaggaaaatgactacatt
aattcatactttgaagatggagatgattttggcgcagacagtgatgacaacatggatgag
gcaacctattag

KEGG   Homo sapiens (human): 10623Help
Entry
10623             CDS       T01001                                 

Gene name
POLR3C, RPC3, RPC62
Definition
(RefSeq) RNA polymerase III subunit C
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    10623 (POLR3C)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    10623 (POLR3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10623 (POLR3C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     10623 (POLR3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc82 HTH_9 NIT Cut12
Motif
Other DBs
NCBI-GeneID: 10623
NCBI-ProteinID: NP_006459
OMIM: 617454
HGNC: 30076
Ensembl: ENSG00000186141
Vega: OTTHUMG00000013753
Pharos: Q9BUI4(Tdark)
UniProt: Q9BUI4 A0A024R4C1
Structure
PDB: 

Position
1q21.1
AA seq 534 aa AA seqDB search
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcagaaattaagctctgttctttgttgctgcaagagcattttggagagatt
gtagaaaaaattggagtccatctgataagaaccggcagccagccactaagagtaattgcc
catgacacaggaacatcactggatcaggtgaagaaagccctgtgtgtcctcgtccaacat
aacctggtgagttatcaagtgcacaaacgtggtgtggtggagtatgaagcccagtgcagc
cgggtattgcgaatgcttagatatccccggtacatctatactaccaaaactctgtacagt
gacactggagagctgattgttgaggagcttctgttgaacggcaaactgacaatgtcagct
gttgtgaagaaagtggcagaccggctcacagagaccatggaggatggcaagaccatggac
tatgctgaagtatcaaacacatttgtgcgactggcagacacacactttgtacaacgctgc
ccttcggtacctaccactgagaattcagaccctgggccaccaccacctgcccccacactt
gtcattaatgaaaaggacatgtacctggttcctaaactcagcttgatagggaaaggtaaa
aggaggagatcatctgatgaagatgctgctggggagcccaaggccaagagaccaaaatat
actacagataacaaggagcccattccagatgatgggatttattggcaggccaaccttgac
agattccaccaacacttccgtgaccaagccattgtgagcgcagttgctaacaggatggac
cagacaagcagcgagattgtgcgaaccatgctccgaatgagtgagattaccacttcctct
agtgctcccttcacccagccattgtcttccaatgagatcttcagatccctacctgttggc
tataacatctctaagcaagttcttgatcagtatctcactctgctggcagatgatccacta
gagtttgttggaaagtctggcgacagtggtggaggaatgtatgtcatcaacctccataag
gcattagcatccctagccacagccactctggagtccgtcgtacaggagagatttgggtct
cgctgtgctagaatattccgtctagttttgcagaagaaacacatagagcagaagcaagtg
gaagactttgcaatgattcctgcaaaggaggcaaaggatatgctatataagatgctctca
gaaaatttcatgtcactccaggaaattcccaaaacaccagaccatgccccatccaggacc
ttctatttatatactgtgaacatcctgtcagctgcccgaatgttgttgcacaggtgctac
aagagcatagccaacttgatagaaaggaggcaatttgaaaccaaagagaataagcgtcta
ctagaaaaatctcagagggtagaagccatcattgcatctatgcaggctactggtgcagag
gaagcacagttacaagaaatagaggagatgatcacagctcctgaacgtcagcagctagag
accctgaaacgtaatgtcaacaagttggatgccagtgagatccaggtggacgaaaccatc
ttcctgctggagtcttacattgagtgcaccatgaagagacagtga

KEGG   Homo sapiens (human): 11128Help
Entry
11128             CDS       T01001                                 

Gene name
POLR3A, ADDH, HLD7, RPC1, RPC155, WDRTS, hRPC155
Definition
(RefSeq) RNA polymerase III subunit A
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    11128 (POLR3A)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    11128 (POLR3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    11128 (POLR3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     11128 (POLR3A)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     11128 (POLR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Motif
Other DBs
NCBI-GeneID: 11128
NCBI-ProteinID: NP_008986
OMIM: 614258
HGNC: 30074
Ensembl: ENSG00000148606
Vega: OTTHUMG00000018550
Pharos: O14802(Tbio)
UniProt: O14802
Position
10q22.3
AA seq 1390 aa AA seqDB search
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANF
IQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLC
CQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQVEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFD
TNEFHIPLVT
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggagcagttccgggagacggatgtggccaagaaaataagccacatctgtttt
ggaatgaagtcacctgaggagatgcgccagcaggcgcacatccaagttgtgagtaagaac
ctgtacagccaggacaaccaacatgcccccttgctatatggggtgctcgaccataggatg
ggtacgagtgagaaggatcgtccatgtgaaacctgtgggaaaaacttggctgactgtcta
ggccactatgggtatatcgacctggagttgccgtgttttcatgtagggtacttcagagca
gtcataggcatcttacagatgatctgcaaaacctgctgccacatcatgctgtcccaagag
gagaagaagcagtttctggactatctaaagaggcccggcctgacctaccttcagaagcga
ggactgaaaaagaaaatctctgacaagtgccggaagaaaaacatctgccatcactgtggc
gcttttaatggtaccgtaaagaagtgtggactgctgaaaataattcatgagaaatacaag
accaacaaaaaagtggtggatcccattgtatcaaatttccttcagtcttttgaaacagcc
attgaacataataaagaagtggagcctctgctgggaagggcacaggaaaacttgaatccc
ttagtagttctgaatttatttaaacgaatcccagctgaagatgttcctctacttctgatg
aacccagaagccggaaagccgtctgatttgattctcacacgacttttggtgcctcctttg
tgtatcagaccctccgttgtgagtgatttgaagtctggcaccaatgaagatgatctgaca
atgaaactgacagaaatcattttcctaaacgatgttattaaaaagcatcggatctcagga
gccaagacccagatgatcatggaggactgggatttcctgcagctgcagtgtgccctctac
attaacagtgagctctcgggcattcccctcaacatggcacccaagaagtggaccagaggc
ttcgtccaacgcctgaagggaaaacagggtcgatttagaggaaatctctcaggaaagaga
gtggatttttctggcagaacagtcatctcgcccgaccccaacctccggattgatgaggta
gctgtgccagttcatgtggccaaaattctaacttttcctgagaaggtaaacaaagcaaac
atcaatttcttgaggaaactggttcaaaacggccctgaggttcacccaggagcaaacttc
attcagcagagacatacgcagatgaaaaggtttttgaaatacggaaatcgagaaaagatg
gctcaagagctcaagtatggtgacatcgtagagagacacctcatcgatggagatgtggtg
ctgttcaatcggcagccctcgctgcacaaattgagcattatggctcatctggccagggtc
aagccccaccggaccttcagatttaatgagtgtgtctgtacaccctataatgctgacttt
gatggtgatgaaatgaaccttcatcttcctcaaacagaagaagctaaagcagaggccctt
gttctgatggggactaaagcaaatcttgtaaccccgaggaatggggaaccgctgattgct
gctattcaggattttctaacaggtgcctatctcctcactctcaaggacactttctttgat
cgagccaaggcttgccaaatcattgcttcaatactggttggcaaggatgagaaaattaaa
gttcgcctcccaccgcctacaatcctaaagcctgtcaccctgtggacgggaaagcagatc
ttcagtgtcatcctcaggcctagcgatgacaatccagtgagggccaacctgcgaaccaag
ggcaagcagtactgtggcaaaggggaagatctctgtgccaatgattcctatgttacaatc
cagaacagtgagttgatgagtggcagcatggacaaaggaaccctagggtcaggatccaag
aacaatattttttacattttgctgcgagactggggacagaatgaagctgcagatgccatg
tcacggctcgccaggctggctcctgtctacctgtctaaccgtggtttctcaattgggatc
ggtgatgtcacacctggccaaggactgctgaaggccaagtatgagttgctgaatgccggc
tacaagaaatgtgatgagtacatcgaagccctgaacacgggcaagctgcagcagcagcct
ggctgcactgctgaggagaccctggaggcactgatcctgaaggagctgtctgtgatccgt
gaccacgctggcagtgcctgcctccgggagctggacaagagcaacagccccctcaccatg
gctctgtgcggctccaaaggttccttcattaacatatcacagatgattgcctgtgtggga
cagcaggccatcagtggctctcgagtgccagacggctttgaaaacaggtccttgcctcat
tttgaaaaacactcaaagctcccagctgccaaaggctttgtggctaatagcttttattcc
ggtttgacaccaactgagtttttcttccacacaatggccggccgggaaggtctagtcgac
acggctgtaaagacagctgaaacgggatacatgcagcgaaggcttgtcaaatctcttgaa
gatctttgctcccagtatgatctgacagtccgaagctctactggcgatattatccagttc
atttatggaggagatggcttagatcctgcagctatggagggaaaagatgaacctttggag
tttaaaagggttctggacaacatcaaagcagtcttcccgtgtcccagtgagcctgctctc
agcaaaaacgagctgatcctgaccacagagtccatcatgaagaagagtgagttcctctgc
tgccaggacagcttcctgcaggaaataaaaaaattcattaagggggtctctgagaagatc
aagaaaaccagagataaatatggcatcaatgataacggcacaacagagccccgtgtgctg
taccagctggaccgcatcacccccacccaagtagaaaagtttctggagacctgtagggac
aagtacatgagggcacagatggagccaggttctgcagtgggtgctctgtgtgcccagagc
attggtgagccaggcacccagatgaccctgaagactttccactttgcaggtgtggcctcc
atgaacatcaccctgggcgtgccccggattaaagagatcatcaacgcttccaaggccatc
agcactccaattatcacagcacagctagacaaggatgacgacgcggattatgctcgcctc
gtgaaagggagaattgagaaaaccctcttgggagagatttccgagtatattgaagaagtg
tttcttcctgatgactgctttattctcgtcaagctctccctggaacggattaggcttctg
agactggaagtgaacgctgagacagtgagatattccatctgcacatccaagctccgtgtg
aagcccggtgatgtggctgttcatggtgaggctgtggtgtgtgtcacccccagagagaac
agcaagagctccatgtactacgtgctgcagttcctgaaagaggatctccccaaggtggtg
gtgcagggcattccagaggtgtccagagctgtcatccacattgacgagcagagtggaaag
gagaagtacaagcttctggtggaaggtgataacctgcgggcagtcatggccacacacggt
gtgaagggcacccgaaccacctccaataacacctatgaggtggagaaaactctgggcatc
gaggccgcccggacaacgatcatcaatgaaatccagtacaccatggtgaaccacggcatg
agcatcgacaggaggcacgtgatgctgctctccgacctcatgacctacaagggtgaagtc
ctgggcatcactaggtttggcctggccaagatgaaggagagtgtgctgatgctggcctcc
tttgagaagacggctgaccatctctttgacgctgcctacttcgggcagaaggactctgtg
tgtggggtgtctgagtgcatcatcatgggaatcccaatgaacattggaaccgggctcttc
aagctgcttcacaaggctgacagggacccgaaccctcccaagaggcccctgatcttcgac
acaaatgaattccacatcccccttgtcacatag

KEGG   Homo sapiens (human): 171568Help
Entry
171568            CDS       T01001                                 

Gene name
POLR3H, RPC22.9, RPC8
Definition
(RefSeq) RNA polymerase III subunit H
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    171568 (POLR3H)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    171568 (POLR3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    171568 (POLR3H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     171568 (POLR3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Motif
Other DBs
NCBI-GeneID: 171568
NCBI-ProteinID: NP_001018060
HGNC: 30349
Ensembl: ENSG00000100413
Vega: OTTHUMG00000150971
Pharos: Q9Y535(Tbio)
UniProt: Q9Y535 A0A024R1P3
Position
22q13.2
AA seq 204 aa AA seqDB search
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctggtggaaatggtggacaccgtccggatccccccttggcagtttgagagg
aagctcaacgactccattgccgaggagctgaacaagaagttggccaacaaggtcgtgtac
aacgtgggactctgcatttgtctgtttgatatcaccaaactggaggatgcctatgtattc
cctggggatggcgcatcacacaccaaagtccattttcgctgcgtggtgtttcatccattc
ctagatgagattctcattgggaagatcaaaggctgcagcccagaaggagtgcacgtctct
ctaggcttcttcgatgacattctcatccccccagagtcactgcagcagccagccaagttc
gacgaagcggagcaggtgtgggtgtgggagtacgagacggaggaaggagcacacgacctc
tacatggacaccggcgaggagatccgcttccgggtggtggacgagagctttgttgacacg
tcccccacagggcccagctcagcagatgccaccacttccagtgaggagctgccaaagaag
gaggctccgtacacgcttgtgggatccatcagtgagccaggcctgggccttctctcctgg
tggaccagcaactag

KEGG   Homo sapiens (human): 51082Help
Entry
51082             CDS       T01001                                 

Gene name
POLR1D, AC19, POLR1C, RPA16, RPA9, RPAC2, RPC16, RPO1-3, TCS2
Definition
(RefSeq) RNA polymerase I and III subunit D
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Disease
H00610  Treacher Collins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    51082 (POLR1D)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    51082 (POLR1D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51082 (POLR1D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     51082 (POLR1D)
  RNA polymerase I system
   RNA polymerase I
     51082 (POLR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 51082
NCBI-ProteinID: NP_057056
OMIM: 613715
HGNC: 20422
Ensembl: ENSG00000186184
Vega: OTTHUMG00000016635
Pharos: Q9Y2S0(Tbio)
UniProt: P0DPB6
Position
13q12.2
AA seq 133 aa AA seqDB search
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKD
YKDQKASRNESTF
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggatcaggagctggagagaaaaatatctggattgaagacctcaatggctgaa
ggcgagaggaagacagccctggaaatggtccaggcagctggaacagatagacactgtgtg
acatttgtattgcacgaggaagaccataccctaggaaattctctacgttacatgatcatg
aagaacccggaagtggaattttgtggttacactacgacccatccttcagagagcaaaatt
aatttacgcattcagactcgaggtacccttccagctgttgagccatttcagagaggcctg
aatgagctcatgaatgtctgccaacatgtgcttgacaagtttgaggccagcataaaggac
tataaggatcaaaaagcaagcagaaatgaatccacattctag

KEGG   Homo sapiens (human): 51728Help
Entry
51728             CDS       T01001                                 

Gene name
POLR3K, C11, C11-RNP3, My010, RPC10, RPC11, RPC12.5
Definition
(RefSeq) RNA polymerase III subunit K
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    51728 (POLR3K)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    51728 (POLR3K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    51728 (POLR3K)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     51728 (POLR3K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Nudix_N_2 zf-SAP30 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 51728
NCBI-ProteinID: NP_057394
OMIM: 606007
HGNC: 14121
Ensembl: ENSG00000161980
Vega: OTTHUMG00000060722
Pharos: Q9Y2Y1(Tdark)
UniProt: Q9Y2Y1
Position
16p13.3
AA seq 108 aa AA seqDB search
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttctgccccggctgcgggaacgggctgatcgtggaggagggacaacgctgc
caccgcttcgcctgcaacacgtgcccctacgtgcacaacatcacccgcaaggtaacaaat
cggaagtacccaaaactgaaagaagtggatgatgtgcttggtggagcagctgcctgggag
aatgttgactctactgcagagtcgtgtcccaaatgcgaacatcctcgtgcttacttcatg
cagcttcagacccgctctgcagatgagccgatgaccaccttctacaagtgctgcaatgct
cagtgtggacaccgctggagggattag

KEGG   Homo sapiens (human): 5434Help
Entry
5434              CDS       T01001                                 

Gene name
POLR2E, RPABC1, RPB5, XAP4, hRPB25, hsRPB5
Definition
(RefSeq) RNA polymerase II subunit E
  KO
K03013  DNA-directed RNA polymerases I, II, and III subunit RPABC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5434 (POLR2E)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5434 (POLR2E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5434 (POLR2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5434 (POLR2E)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5434 (POLR2E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5434 (POLR2E)
  RNA polymerase III system
   RNA polymerase III
     5434 (POLR2E)
  RNA polymerase I system
   RNA polymerase I
     5434 (POLR2E)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5434 (POLR2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb5_C RNA_pol_Rpb5_N
Motif
Other DBs
NCBI-GeneID: 5434
NCBI-ProteinID: NP_002686
OMIM: 180664
HGNC: 9192
Ensembl: ENSG00000099817
Vega: OTTHUMG00000181873
Pharos: P19388(Tbio)
UniProt: P19388
Structure
PDB: 

Position
19p13.3
AA seq 210 aa AA seqDB search
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaggaggagacgtaccggctctggaaaatccgcaagaccatcatgcagctg
tgccacgaccgtggctatctggtgacccaggacgagcttgaccagaccctggaggagttc
aaagcccaatttggggacaagccgagtgaggggcggccgcggcgcacggacctcaccgtg
ctggtggcccacaacgatgaccccaccgaccagatgtttgtgttctttccagaggagccc
aaggtgggcatcaagaccatcaaggtgtactgccagcgcatgcaggaggagaacatcaca
cgggctctcatcgtggtgcagcagggcatgacaccctccgccaagcagtccctggtcgac
atggcccccaagtacatcctggagcagtttctgcagcaggagctgctcatcaacatcacg
gagcacgagctagtccctgagcacgtcgtcatgaccaaggaggaggtgacagagctgctg
gcccgatataagctccgagagaaccagctgcccaggatccaggcgggggaccctgtggcg
cgctactttgggataaagcgtgggcaggtggtgaagatcatccggcccagtgagacggct
ggcaggtacatcacctaccggctggtgcagtag

KEGG   Homo sapiens (human): 5435Help
Entry
5435              CDS       T01001                                 

Gene name
POLR2F, HRBP14.4, POLRF, RPABC14.4, RPABC2, RPB14.4, RPB6, RPC15
Definition
(RefSeq) RNA polymerase II subunit F
  KO
K03014  DNA-directed RNA polymerases I, II, and III subunit RPABC2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5435 (POLR2F)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5435 (POLR2F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5435 (POLR2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5435 (POLR2F)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5435 (POLR2F)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5435 (POLR2F)
  RNA polymerase III system
   RNA polymerase III
     5435 (POLR2F)
  RNA polymerase I system
   RNA polymerase I
     5435 (POLR2F)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5435 (POLR2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb6 BDHCT_assoc
Motif
Other DBs
NCBI-GeneID: 5435
NCBI-ProteinID: NP_068809
OMIM: 604414
HGNC: 9193
Ensembl: ENSG00000100142
Vega: OTTHUMG00000151160
Pharos: P61218(Tbio)
UniProt: P61218
Structure
PDB: 

Position
22q13.1
AA seq 127 aa AA seqDB search
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacgaggacaattttgatggcgacgactttgatgatgtggaggaggatgaa
gggctagatgacttggagaatgccgaagaggaaggccaggagaatgtcgagatcctcccc
tctggggagcgaccgcaggccaaccagaagcgaatcaccacaccatacatgaccaagtac
gagcgagcccgcgtgctgggcacccgagcgctccagattgcgatgtgtgcccctgtgatg
gtggagctggagggggagacagatcctctgctcattgccatgaaggaactcaaggcccga
aagatccccatcatcattcgccgttacctgccagatgggagctatgaagactggggggtg
gacgagctcatcatcaccgactga

KEGG   Homo sapiens (human): 5437Help
Entry
5437              CDS       T01001                                 

Gene name
POLR2H, RPABC3, RPB17, RPB8
Definition
(RefSeq) RNA polymerase II subunit H
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5437 (POLR2H)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5437 (POLR2H)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5437 (POLR2H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5437 (POLR2H)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5437 (POLR2H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5437 (POLR2H)
  RNA polymerase III system
   RNA polymerase III
     5437 (POLR2H)
  RNA polymerase I system
   RNA polymerase I
     5437 (POLR2H)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5437 (POLR2H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Motif
Other DBs
NCBI-GeneID: 5437
NCBI-ProteinID: NP_006223
OMIM: 606023
HGNC: 9195
Ensembl: ENSG00000163882
Vega: OTTHUMG00000156746
Pharos: P52434(Tbio)
UniProt: P52434
Structure
PDB: 

Position
3q27.1
AA seq 150 aa AA seqDB search
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcctgtttgaggatattttcgatgtgaaggatattgacccggagggcaag
aagtttgaccgagtgtctcgactgcattgtgagagtgaatctttcaagatggatctaatc
ttagatgtaaacattcaaatttaccctgtagacttgggtgacaagtttcggttggtcata
gctagtaccttgtatgaagatggtaccctggatgatggtgaatacaaccccactgatgat
aggccttccagggctgaccagtttgagtatgtaatgtatggaaaagtgtacaggattgag
ggagatgaaacttctactgaagcagcaacacgcctctctgcgtacgtgtcctatgggggc
ctgctcatgaggctgcagggggatgccaacaacctgcatggattcgaggtggactccaga
gtttatctcctgatgaagaagctagccttctga

KEGG   Homo sapiens (human): 5440Help
Entry
5440              CDS       T01001                                 

Gene name
POLR2K, ABC10-alpha, RPABC4, RPB10alpha, RPB12, RPB7.0, hRPB7.0, hsRPB10a
Definition
(RefSeq) RNA polymerase II subunit K
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5440 (POLR2K)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5440 (POLR2K)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5440 (POLR2K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5440 (POLR2K)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5440 (POLR2K)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5440 (POLR2K)
  RNA polymerase III system
   RNA polymerase III
     5440 (POLR2K)
  RNA polymerase I system
   RNA polymerase I
     5440 (POLR2K)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5440 (POLR2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 HypA MCM_OB DZR zinc_ribbon_13
Motif
Other DBs
NCBI-GeneID: 5440
NCBI-ProteinID: NP_005025
OMIM: 606033
HGNC: 9198
Ensembl: ENSG00000147669
Vega: OTTHUMG00000164705
Pharos: P53803(Tbio)
UniProt: P53803 A0A024R9G0
Structure
PDB: 

Position
8q22.2
AA seq 58 aa AA seqDB search
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atggacacccagaaggacgttcaacctccaaagcagcaaccaatgatatatatctgtgga
gagtgtcacacagaaaatgaaataaaatctagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaaaagattggtcgtttttgatgctcgatga

KEGG   Homo sapiens (human): 5441Help
Entry
5441              CDS       T01001                                 

Gene name
POLR2L, RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6
Definition
(RefSeq) RNA polymerase II subunit L
  KO
K03007  DNA-directed RNA polymerases I, II, and III subunit RPABC5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    5441 (POLR2L)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    5441 (POLR2L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    5441 (POLR2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    5441 (POLR2L)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5441 (POLR2L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     5441 (POLR2L)
  RNA polymerase III system
   RNA polymerase III
     5441 (POLR2L)
  RNA polymerase I system
   RNA polymerase I
     5441 (POLR2L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      5441 (POLR2L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_N
Motif
Other DBs
NCBI-GeneID: 5441
NCBI-ProteinID: NP_066951
OMIM: 601189
HGNC: 9199
Ensembl: ENSG00000177700
Vega: OTTHUMG00000133316
Pharos: P62875(Tbio)
UniProt: P62875
Structure
PDB: 

Position
11p15.5
AA seq 67 aa AA seqDB search
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgatcatccctgtacgctgcttcacttgtggcaagatcgtcggcaacaagtgggaggct
tacctggggctgctgcaggccgagtacaccgagggggatgcgctggatgccctgggcctg
aagcgctactgctgccgccggatgctgctggcccacgtggacctgatcgagaagctgctc
aattatgcacccctggagaagtga

KEGG   Homo sapiens (human): 55703Help
Entry
55703             CDS       T01001                                 

Gene name
POLR3B, C128, HLD8, INMAP, RPC2
Definition
(RefSeq) RNA polymerase III subunit B
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Disease
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    55703 (POLR3B)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    55703 (POLR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55703 (POLR3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     55703 (POLR3B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     55703 (POLR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Motif
Other DBs
NCBI-GeneID: 55703
NCBI-ProteinID: NP_060552
OMIM: 614366
HGNC: 30348
Ensembl: ENSG00000013503
Vega: OTTHUMG00000170077
Pharos: Q9NW08(Tbio)
UniProt: Q9NW08 Q7Z3R8
Position
12q23.3
AA seq 1133 aa AA seqDB search
MDVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVNTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLSKYNE
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgctagcggaggagtttgggaacctgactccggagcagctggcggcgccgatc
ccgactgtagaggaaaaatggaggctgcttccagcatttttaaaggtgaaaggccttgtg
aaacagcatatagattcatttaactatttcattaatgtagagataaagaagataatgaaa
gccaatgaaaaggttacaagtgacgctgaccctatgtggtacttaaaatatcttaatatc
tatgttgggcttcctgatgttgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtttgagagacatgacatactctgcccctattacagtggatattgaatatacc
cgaggcagccagaggatcatccgcaatgccttacctatcggcagaatgcccataatgcta
cgtagttcaaactgtgttcttacaggaaaaacgccagcagaatttgccaaactgaacgaa
tgtcccttagatccaggtggctacttcattgttaaaggagtagaaaaagttattcttatc
caagagcagctgtctaagaacaggatcatcgtggaggctgatagaaaaggggctgttgga
gcttcagttaccagctctacccatgagaaaaaaagcagaaccaatatggctgtgaaacaa
ggacgattttatttgaggcataatactttgtcagaagatatacccattgtcatcatattt
aaggccatgggtgttgagagtgaccaggaaattgtgcagatgattggaacagaggagcac
gtgatggctgcatttgggcccagtctggaagagtgccagaaagctcagattttcacacag
atgcaggcattaaaatatatagggaacaaagtaagaaggcaaaggatgtggggaggtgga
ccaaagaaaaccaaaatagaagaagcaagagagctcctggcttccaccattctgacccat
gtcccagttaaggaattcaatttccgagccaaatgtatctatactgcagtgatggtgcga
agagttattctggcccaaggagataataaagttgacgacagagattattatggtaacaag
cgactggaattggcaggacagcttttatctcttctttttgaagacttgttcaaaaaattt
aattctgaaatgaaaaagattgccgaccaggtgattcctaagcaaagagcagcccagttt
gatgttgtcaaacacatgcgccaagaccagatcaccaatggcatggtgaatgctatttct
accggaaattggtctttaaagagatttaaaatggaccgccagggtgtaacccaagtgctg
tctcgcttgtcatatatatccgcactgggcatgatgacaagaatctcttcccagtttgaa
aaaacgagaaaagtgagtggtcctcgctccctccagccatctcagtggggaatgctgtgt
ccttcggacactcctgaaggagaggcatgtggtttggttaaaaacttggcccttatgaca
cacatcacaactgatatggaagatggacccattgttaaattagccagtaacttgggagta
gaagatgtgaatttattatgtggggaagagctctcttacccaaatgtgtttcttgtcttt
cttaatggtaacatcttaggtgtcattcgagaccacaaaaagctagtgaatacatttcga
ctcatgagaagagcaggatatatcaatgaatttgtttccatctcaacaaatcttacagat
cgatgtgtctatatttcttctgatgggggaaggctatgcagaccctacataattgtcaag
aaacagaagccagcagtcacaaataaacatatggaagagctggcccaagggtacaggaat
tttgaagatttcttacatgagagtctggttgaatatttagatgtgaatgaagaaaatgat
tgtaacattgcactgtacgaacacacaattaataaagacaccacccacttggagattgaa
cccttcactcttctcggcgtgtgtgctggacttatcccataccctcaccataaccagtca
ccgagaaacacttatcagtgtgccatggggaaacaagccatgggtactataggatacaac
cagcgaaacagaattgatactctcatgtatctactagcatatccacaaaaacccatggtt
aagacaaaaaccattgaattgatagaatttgagaaactgccagctggacagaatgcaaca
gttgctgtgatgagctatagtggctatgatattgaagatgctcttgttttaaacaaggcc
tctttagacagaggctttgggcgttgccttgtatataaaaatgctaaatgtacgttgaaa
cgatacaccaatcagacttttgataaagtgatggggcccatgttggatgctgctacaagg
aaacctatctggcgacatgaaatcttagatgcagatggtatttgttctccaggtgagaaa
gtagaaaacaaacaagtgcttgtaaataagtccatgcccacagtgactcagattcctttg
gaaggaagtaatgtaccacagcaaccacagtacaaagatgtacccataacctacaaagga
gcaacagactcatatattgaaaaagtgatgatatcttcaaatgctgaagatgcttttctg
atcaaaatgctgctgagacagacaaggcgtccagaaattggagacaaattcagcagtcgt
catgggcaaaaaggtgtttgtggcttgatcgtcccccaggaagacatgccattttgtgat
tctggcatctgtccggacatcatcatgaacccacacggcttcccatcacgaatgacggtg
gggaagctcattgagctgctggctggcaaggccggtgtgctggacggcagattccactac
ggcactgcgtttggaggcagtaaagtgaaggatgtgtgtgaggacctcgttcgccatggt
tataactacttggggaaagactatgttacatccggcatcacaggtgagcccttagaagca
tacatctattttggccccgtgtactatcagaagctgaaacacatggtgctagataaaatg
catgcccgggcccggggcccacgagccgtccttaccaggcaacccactgaaggacggtct
cgtgatggtggcttgcgtctcggggaaatggaacgtgactgtttaatcggttatggagcc
agtatgcttttgctagagagactaatgatttcaagtgatgcctttgaggttgatgtctgt
gggcagtgtggacttctggggtattctggctggtgccattactgcaagtcatcctgccac
gtgtcttccctccgtattccgtatgcctgcaagctgctcttccaggaactacagtctatg
aacatcatccccaggttaaaactgtccaagtacaatgaatga

KEGG   Homo sapiens (human): 55718Help
Entry
55718             CDS       T01001                                 

Gene name
POLR3E, RPC5, SIN
Definition
(RefSeq) RNA polymerase III subunit E
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    55718 (POLR3E)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    55718 (POLR3E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    55718 (POLR3E)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     55718 (POLR3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sin_N
Motif
Other DBs
NCBI-GeneID: 55718
NCBI-ProteinID: NP_060589
OMIM: 617815
HGNC: 30347
Ensembl: ENSG00000058600
Vega: OTTHUMG00000094779
Pharos: Q9NVU0(Tbio)
UniProt: Q9NVU0
Position
16p12.2
AA seq 708 aa AA seqDB search
MANEEDDPVVQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEDDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGLRDSRSEHERQYLLCPGSSGVENTELVK
SPSEYLMMLMPPSQEEEKDKPVAPSNVLSMAQLRTLPLADQIKILMKNVKVMPFANLMSL
LGPSIDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGVPAEVLCRGRDFVMWKF
TQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQH
MLWTGIQAKLEKVYNLVKETMPKKPDAQSGPAGLVCGDQRIQVAKTKAQQNHALLERELQ
RRKEQLRVPAVPPGVRIKEEPVSEEGEEDEEQEAEEEPMDTSPSGLHSKLANGLPLGRAA
GTDSFNGHPPQGCASTPVARELKAFVEATFQRQFVLTLSELKRLFNLHLASLPPGHTLFS
GISDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKN
YRVRRNMIQSRLTQECGEDLSKQEVDKVLKDCCVSYGGMWYLKGTVQS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaagaggatgacccagttgtacaggagatcgatgtgtacttggccaagagt
ctggcggaaaagctgtatctatttcagtaccctgtgcgtccagcctcgatgacctacgat
gacattccgcacctctcagccaagatcaagcccaagcagcagaaggtagagcttgagatg
gccatcgacaccctgaaccccaactattgccgcagcaaaggggagcagattgcgctgaac
gtggacggggcctgcgccgacgagaccagcacgtattcctcgaagctgatggacaagcag
accttctgctcttcccagaccaccagtaacacatcccgttatgccgctgcactctacagg
caaggtgagctccacctgacacctttacatggcatcctgcagctgcggcccagcttctcc
tacctggataaggctgacgccaagcaccgggagagggaggcggccaacgaggcaggggac
tcttcacaggatgaggcggaagacgatgttaagcagatcacggtgcggttctcccggccg
gagtcagagcaggcccgccagcgccgtgtgcagtcctatgagttcctgcagaagaagcac
gcagaggagccctgggtccacctgcattactatggcctgagggacagtcgctctgagcat
gagcgtcagtacctgctgtgccccggctcaagcggggtggagaacacggagctcgtcaag
tcacccagtgagtacctgatgatgctgatgccacccagccaggaggaggagaaagacaag
cctgtggcccccagcaacgtcctgtcgatggcccagctgcgcacgctgcccctggccgat
cagatcaagatcctgatgaagaatgtgaaggtcatgccttttgccaacttgatgagcctc
ctgggcccctccatcgattccgtggctgttctgcggggcatccagaaggtggcgatgttg
gtccaagggaactgggtggtgaagagtgacatcctataccccaaggactcgtccagccct
cacagcggcgtgcctgctgaggtgctctgcaggggccgagacttcgttatgtggaagttc
acgcagagccgctgggtggttaggaaagaggtggcaaccgtgaccaaactctgcgccgag
gatgtgaaggacttcctggagcacatggccgtggtgaggatcaacaaaggctgggagttc
attctgccttatgatggggagttcatcaagaagcacccggatgtggtccagcggcagcac
atgctgtggacgggtatccaggccaaactggaaaaagtctataatcttgtaaaggaaacc
atgccaaagaagccggatgcacaatcagggcctgccgggctggtctgtggggaccagcgg
atccaagtagccaaaaccaaggcccagcagaaccacgcgttgctggagcgggagctgcag
cggcggaaggagcagctgcgggtgcctgcggtcccgcccggtgtgcggatcaaggaggag
cccgtgagcgaggagggcgaggaggacgaggagcaggaggcggaggaggagcccatggac
acttcccccagcggcctccacagcaagctggccaacgggctgcctctcgggcgggctgcg
ggcacagacagcttcaacgggcacccgccccagggctgcgccagcacccctgtggctcgg
gaactgaaggccttcgtggaggccacctttcagagacagtttgtgctcacgctgagcgaa
ctcaagcgcctcttcaatctgcacttggccagcctgccccccggccacacactcttcagc
ggcatctcggaccgcatgctacaggacacggtgctggccgccggttgcaagcagatactg
gtgccttttcccccccagactgctgcttccccggatgagcagaaggtgtttgccctctgg
gagtctggagacatgagtgatcagcatcgacaggttttgcttgaaattttttccaaaaat
taccgggtacgccgaaacatgatccagtctcggttgactcaagagtgtggagaagatctc
agtaaacaggaggtggataaagtactaaaggactgctgtgtaagctatggtggcatgtgg
taccttaaagggacagtacagtcttga

KEGG   Homo sapiens (human): 661Help
Entry
661               CDS       T01001                                 

Gene name
POLR3D, BN51T, RPC4, RPC53, TSBN51
Definition
(RefSeq) RNA polymerase III subunit D
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    661 (POLR3D)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    661 (POLR3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    661 (POLR3D)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     661 (POLR3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 661
NCBI-ProteinID: NP_001713
OMIM: 187280
HGNC: 1080
Ensembl: ENSG00000168495
Vega: OTTHUMG00000163778
Pharos: P05423(Tbio)
UniProt: P05423
Position
8p21.3
AA seq 398 aa AA seqDB search
MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQL
PLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAAR
KTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVL
IKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaggaaacgccgccggcgagcccagcacgccgggagggccccgacctctcctg
actggggcccgggggctcatcgggcggcggccggcgcctcccctcacccccggccgcctt
ccctccatccgttccagggacctcaccctcgggggagtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaggaagagcccaaggaagaagtaactgtcaagaaggag
aagcgtgaaagggacagagaccgacaacgagaggggcatggacgagggcgaggccgtcca
gaagtgatccagtctcactccatctttgagcagggcccagctgaaatgatgaagaaaaaa
gggaactgggataagacagtggatgtgtcagacatgggaccttctcatatcatcaacatc
aaaaaagagaagagagagacagacgaagaaactaaacagatcttgcgtatgctggagaag
gacgatttcctcgatgaccccggcctgaggaacgacactcgaaatatgcctgtgcagctg
ccgctggctcactcaggatggctttttaaggaagaaaatgacgaaccagatgttaaacct
tggctggctggccccaaggaagaggacatggaggtggacatacctgctgtgaaagtgaaa
gaggagccacgagatgaggaggaagaggccaagatgaaggctcctcccaaagcagccagg
aagactccaggcctcccgaaggatgtatctgtggcagagctgctgagggagctgagcctc
accaaggaagaggaactgctgtttctgcagctgccagacaccctccctggccagccaccc
acccaggacatcaagcctatcaagacagaggtgcagggcgaggacggacaggtggtgctc
atcaagcaggagaaagaccgagaagccaaattggcagagaatgcttgtaccctggctgac
ctgacagagggtcaggttggcaagctactcatccgcaagtctggaagggtgcaactcctc
ttgggcaaggtgactctggacgtgaccatgggaactgcctgctccttcctgcaggagctg
gtgtccgtgggccttggagacagtaggacaggggagatgacagtcctgggacacgtgaag
cacaaacttgtatgttcccctgattttgaatccctcttggatcacaaacaccggtaa

KEGG   Homo sapiens (human): 84265Help
Entry
84265             CDS       T01001                                 

Gene name
POLR3GL, RPC32HOM, flj32422
Definition
(RefSeq) RNA polymerase III subunit G like
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    84265 (POLR3GL)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    84265 (POLR3GL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    84265 (POLR3GL)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     84265 (POLR3GL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_3_Rpc31 Pox_Ag35 DUF87 RNA_pol_Rpc4 DUF4746 FAM176 NOA36 DUF913 TFIIIC_delta Myc_N DUF4820 NPR3
Motif
Other DBs
NCBI-GeneID: 84265
NCBI-ProteinID: NP_115681
OMIM: 617457
HGNC: 28466
Ensembl: ENSG00000121851
Vega: OTTHUMG00000013739
Pharos: Q9BT43(Tbio)
UniProt: Q9BT43
Position
1q21.1
AA seq 218 aa AA seqDB search
MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYV
LALKQELRGAMRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIR
VRKLQKERITILLPKRPPKTTEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEE
EEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccagccggggtgggggccggggtcgtggccggggccagttgaccttcaacgtggag
gccgtgggcattgggaaaggggatgctttgcccccacccaccctgcagccttctccactc
ttccctcccttggagttccgcccagtacctttgccctcaggcgaggaaggggaatatgtc
ctggcactgaagcaagagctacgaggagccatgaggcagctcccctacttcatccggcca
gctgtccccaagagagatgtggagcgttattcagacaaatatcagatgtcaggtccgatt
gacaatgccatcgattggaaccctgattggcggcgtctaccccgggagctaaagatccga
gtgcggaagctacagaaggaacggattacaattctgctccccaagaggccccctaagacc
acagaagataaggaggaaacaatacagaaactagagaccctggagaagaaggaagaagaa
gtaacttcagaggaggatgaggagaaagaagaagaagaagagaaggaagaggaggaagaa
gaagagtatgatgaagaagaacatgaagaggaaactgattacatcatgtcatattttgac
aatggagaggactttggtggtgacagtgatgacaatatggacgaggctatatactga

KEGG   Homo sapiens (human): 9533Help
Entry
9533              CDS       T01001                                 

Gene name
POLR1C, AC40, HLD11, RPA39, RPA40, RPA5, RPAC1, RPC40, TCS3
Definition
(RefSeq) RNA polymerase I and III subunit C
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03020  RNA polymerase
hsa04623  Cytosolic DNA-sensing pathway
Disease
H00610  Treacher Collins syndrome
H00679  Hypomyelinating leukodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    9533 (POLR1C)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    9533 (POLR1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9533 (POLR1C)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     9533 (POLR1C)
  RNA polymerase I system
   RNA polymerase I
     9533 (POLR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Motif
Other DBs
NCBI-GeneID: 9533
NCBI-ProteinID: NP_976035
OMIM: 610060
HGNC: 20194
Ensembl: ENSG00000171453
Vega: OTTHUMG00000014739
Pharos: O15160(Tbio)
UniProt: O15160
Position
6p21.1
AA seq 346 aa AA seqDB search
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPR
LFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGN
QADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDIT
LLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttctcaggcggtggaggaaatgcggagccgcgtggttctgggggagtttggg
gttcgcaatgtccatactactgactttcccggtaactattccggttatgatgatgcctgg
gaccaggaccgcttcgagaagaatttccgtgtggatgtagtacacatggatgaaaactca
ctggagtttgacatggtgggaattgacgcagccattgccaatgcttttcgacgaattctg
ctagctgaggtgccaactatggctgtggagaaggtcctggtgtacaataatacatccatt
gttcaggatgagattcttgctcaccgtctggggctcattcccattcatgctgatccccgt
ctttttgagtatcggaaccaaggagatgaagaaggcacagagatagatactctacagttt
cgtctccaggtcagatgcactcggaacccccatgctgctaaagattcctctgaccccaac
gaactgtacgtgaaccacaaagtgtataccaggcatatgacatggatccccctggggaac
caggctgatctctttccagagggcactatccgaccagtgcatgatgatatcctcatcgct
cagctgcggcctggccaagaaattgacctgctcatgcactgtgtcaagggcattggcaaa
gatcatgccaagttttcaccagtggcaacagccagttacaggctcctgccagacatcacc
ctgcttgagcccgtggaaggggaggcagctgaggagttgagcaggtgcttctcacctggt
gttattgaggtgcaggaagtccaaggtaaaaaggtggccagagttgccaacccccggctg
gataccttcagcagagaaatcttccggaatgagaagctaaagaaggttgtgaggcttgcc
cgggttcgagatcattatatcttctctgttgagtcaacgggggtgttgccaccagatgtg
ctggtgagtgaagccatcaaagtactgatggggaagtgccggcgcttcttggatgaacta
gatgcggttcagatggactga

DBGET integrated database retrieval system