KEGG   Homo sapiens (human): 10113
Entry
10113             CDS       T01001                                 

Symbol
PREB, SEC12
Name
(RefSeq) prolactin regulatory element binding
  KO
K14003  prolactin regulatory element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01289  COPII vesicle formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10113 (PREB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10113 (PREB)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10113 (PREB)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 10113
NCBI-ProteinID: NP_037520
OMIM: 606395
HGNC: 9356
Ensembl: ENSG00000138073
Vega: OTTHUMG00000097076
Pharos: Q9HCU5(Tbio)
UniProt: Q9HCU5
Structure
PDB: 
5TF2

Position
2p23.3
AA seq 417 aa
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSAS
LLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKG
AAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRV
WKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPTF
SSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH
EVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRGPE
LLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQSAFPGFL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggccggcgccgggcgccagagctgtaccgggctccgttcccgttgtacgcgcttcag
gtcgaccccagcactgggctgctcatcgctgcgggcggaggaggcgccgccaagacaggc
ataaagaatggcgtgcactttctgcagctagagctgattaatgggcgcttgagtgcctcc
ttgctgcactcccatgacacagagacacgggccaccatgaacttggcactggctggtgac
atccttgctgcagggcaggatgcccactgtcagctcctgcgcttccaggcacatcaacag
cagggcaacaaggcagagaaggccggttccaaggagcaggggcctcgacaaaggaaggga
gcagccccagcagagaagaaatgtggagcggaaacccagcacgaggggctagaactcagg
gtagagaatttgcaggcggtgcagacagactttagctccgatccactgcagaaagttgtg
tgcttcaaccacgataataccctgcttgccactggaggaacagatggctacgtccgtgtc
tggaaggtgcccagcctggagaaggttctggagttcaaagcccacgaaggggagattgaa
gacctggctttagggcctgatggcaagttggtaaccgtgggccgggaccttaaggcctct
gtgtggcagaaggatcagctggtgacacagctgcactggcaagaaaatggacccaccttt
tccagcacaccttaccgctaccaggcctgcaggtttgggcaggttccagaccagcctgct
ggcctgcgactcttcacagtgcaaattccccacaagcgcctgcgccagccccctccctgc
tacctcacagcctgggatggctccaacttcttgccccttcggaccaagtcctgtggccat
gaagtcgtctcctgcctcgatgtcagtgaatccggcaccttcctaggcctgggcacagtc
actggctctgttgccatctacatagctttctctctccagtgcctctactacgtgagggag
gcccatggcattgtggtgacggatgtggcctttctacctgagaagggtcgtggtccagag
ctccttgggtcccatgaaactgccctgttctctgtggctgtggacagtcgttgccagctg
catctgttgccctcacggcggagtgttcctgtgtggctcctgctcctgctgtgtgtcggg
cttattattgtgaccatcctgctgctccagagtgcctttccaggtttcctttag

DBGET integrated database retrieval system