KEGG   Homo sapiens (human): 10116Help
Entry
10116             CDS       T01001                                 

Gene name
FEM1B, F1A-ALPHA, F1AA, FEM1-beta
Definition
(RefSeq) fem-1 homolog B
  KO
K10349  Fem-1 homolog b
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10116 (FEM1B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Target recognizing subunit (VHL box)
     10116 (FEM1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 10116
NCBI-ProteinID: NP_056137
OMIM: 613539
HGNC: 3649
Ensembl: ENSG00000169018
Vega: OTTHUMG00000133285
Pharos: Q9UK73(Tbio)
UniProt: Q9UK73
Position
15q23
AA seq 627 aa AA seqDB search
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAK
VVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVT
NSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADP
NAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLS
HADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIH
AYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEF
EQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQ
SMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPR
TREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIV
QYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCL
AARAVRANDINYQDQIPRTLEEFVGFH
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggagggcctggctggctatgtatacaaggcggccagcgagggcaaggtgctgactctg
gccgccttgcttctcaaccggtctgaaagcgacatccgctatctgcttggctatgtcagc
cagcagggagggcagcgctccacgcccctcatcatcgcagcccgcaatggacacgcaaag
gtggtacgcttgctcttagaacattaccgggtgcagactcagcagactggcaccgtccgc
ttcgacgggtatgtcattgatggtgccactgctctttggtgtgcagctggagcaggacat
tttgaagttgttaaacttctagtcagccatggagccaacgtgaaccataccacagtaact
aattcaacccccctgcgggcagcatgctttgatggcagactggacattgtgaaatacttg
gttgaaaataatgccaacatcagcattgccaacaaatatgacaacacctgcctaatgatt
gcggcatataagggacacactgatgtggtcagataccttttagaacaacgtgctgatccc
aatgccaaagcacattgtggagccacagcattgcactttgcagctgaagctgggcacata
gatattgtgaaagagctgataaaatggcgtgctgctatagtagtgaatggccatgggatg
acgccattgaaagtagctgccgaaagctgtaaagctgatgtcgtagaactgttactctct
catgctgattgcgaccgaagaagtcggattgaagctttggaactcttgggtgcctccttt
gcaaatgaccgtgagaactatgacatcataaagacataccactatctatatttagccatg
ttagagaggttccaagatggtgataacattctcgaaaaagaggttcttccaccaatccat
gcttatgggaatagaactgaatgtagaaatcctcaggaactggagtccattcggcaagac
agagatgctcttcatatggaaggccttatagttcgggaacggattttaggtgctgacaat
attgatgtttctcatcccatcatttacagaggagctgtttatgcggataatatggaattt
gagcagtgtatcaagttgtggcttcatgccctgcacctcagacaaaaaggtaacaggaac
acccacaaggatcttcttcgatttgctcaagttttctcacaaatgatacatttgaatgaa
actgtgaaggccccagacatagaatgtgttttgagatgcagtgttttggaaatagaacaa
agtatgaacagagtgaaaaatatttcagatgctgatgtccacaatgctatggacaattat
gaatgtaatctctatacctttctgtatttagtgtgcatctctaccaaaacacagtgcagc
gaagaagatcagtgcaaaattaacaagcagatctacaacctgattcaccttgatcccaga
actcgtgaaggtttcaccttgctgcatctggctgtcaattccaatactccagttgatgat
ttccacaccaatgacgtctgcagctttccaaatgcacttgtcacaaagctcctgctggac
tgtggtgctgaggtgaatgccgtggacaatgagggaaacagtgcccttcatattatcgtt
cagtacaacaggcccatcagtgattttttgaccttgcactccatcatcattagcctagtt
gaagccggagctcacactgacatgacgaataaacagaataagactccgctagacaaaagt
acaactggggtatctgaaatactgcttaaaactcaaatgaagatgagtctcaagtgcctg
gctgcccgagcagttcgggctaatgacattaactaccaagaccagatccccagaactctt
gaagagtttgttggatttcattaa

DBGET integrated database retrieval system