KEGG   Homo sapiens (human): 10124
Entry
10124             CDS       T01001                                 
Symbol
ARL4A, ARL4
Name
(RefSeq) ADP ribosylation factor like GTPase 4A
  KO
K07945  ADP-ribosylation factor-like protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    10124 (ARL4A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl4/Arl7
    10124 (ARL4A)
SSDB
Motif
Pfam: Arf Ras Roc SRPRB G-alpha MMR_HSR1 GTP_EFTU Gtr1_RagA ATP_bind_1 6PF2K RsgA_GTPase AAA_28 DLIC NTPase_1 AAA_18
Other DBs
NCBI-GeneID: 10124
NCBI-ProteinID: NP_001032241
OMIM: 604786
HGNC: 695
Ensembl: ENSG00000122644
Pharos: P40617(Tbio)
UniProt: P40617 A0A024R9Z2
Position
7:12686903..12690958
AA seq 200 aa
MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK
VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR
ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE
KLHDMIIKRRKMLRQQKKKR
NT seq 603 nt   +upstreamnt  +downstreamnt
atggggaatgggctgtcagaccagacttctatcctgtccaacctgccttcatttcagtct
ttccacattgttattctgggtttggactgtgctggaaagacaactgtcttatacaggctg
cagttcaatgaatttgtaaataccgtacctaccaaaggatttaacactgagaaaattaag
gtaaccttgggaaattctaaaacagtcacttttcacttctgggatgtaggtggtcaggag
aaattaaggccactgtggaagtcatataccagatgcacagatggcattgtatttgttgtg
gactctgttgatgtcgaaaggatggaagaagccaaaactgaacttcacaaaataactagg
atatcagaaaatcagggagtccctgtacttatagttgctaacaaacaagatttgaggaac
tcattgtcactttcagaaattgagaaattgttagcaatgggtgaactgagctcatcaact
ccttggcatttgcagcctacctgtgcaatcataggagatggcctaaaggaaggacttgag
aaactacatgatatgatcattaaaagaagaaaaatgttgcggcaacagaaaaagaaaaga
tga

DBGET integrated database retrieval system