KEGG   Homo sapiens (human): 10125Help
Entry
10125             CDS       T01001                                 

Gene name
RASGRP1, CALDAG-GEFI, CALDAG-GEFII, RASGRP
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04611  Platelet activation
hsa04660  T cell receptor signaling pathway
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10125 (RASGRP1)
   04010 MAPK signaling pathway
    10125 (RASGRP1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10125 (RASGRP1)
   04660 T cell receptor signaling pathway
    10125 (RASGRP1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    10125 (RASGRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 EF-hand_7 RasGEF_N EF-hand_5 EF-hand_8 SPARC_Ca_bdg Cep57_CLD_2 bZIP_1 DivIC
Motif
Other DBs
NCBI-GeneID: 10125
NCBI-ProteinID: NP_005730
OMIM: 603962
HGNC: 9878
Ensembl: ENSG00000172575
Vega: OTTHUMG00000172379
Pharos: O95267(Tchem)
UniProt: O95267 B2RA89
Structure
PDB: 

Position
15q14
AA seq 797 aa AA seqDB search
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcctctaaagcaagactagaggcaaagccagccaacagccccttcccctcccatcccagc
ttggcccacatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcagatggaaacctgtgt
cgaagtaaccaactgttgcaagtcatgctgaccatgcaccgaattgtcatctcctctgca
gaactgctccaaaaagttatcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgttattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggacgccagcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacattgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccagaagagctatccgagcacctcacctaccttgagttcaagtct
ttccggaggatatcgttctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagcgatctattgctctgtgcaacggcatctcccagtgggtacaactg
atggttctcagccgccccacgccgcagctccgagcagaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacactgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactacgacaattac
cggcgagcctatggagagtgcaccgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactatctggaggacgggaaagtgaacgtc
cataagctactggccctatacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacccttggaggctaacaaggacttggtacacttgctgacgttatccctggatctttac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccaccactaacaccttcaaagccaccagtagtagtggactgggcttctggagtgtctccc
aaacctgatccaaaaaccattagcaaacacgtccagaggatggtggattctgtcttcaag
aactatgatcacgaccaggatggatacatttctcaggaagaatttgaaaagattgctgcg
agttttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagcagggat
gagatcacagcctacttcatgagagccagctcaatctattccaagctgggcctgggcttt
cctcacaacttccaagagaccacctacctgaagcccactttttgtgacaactgtgctgga
tttctctggggagtgatcaaacaaggatatcgatgtaaagactgcgggatgaactgtcac
aaacaatgcaaagatctggttgtgtttgagtgtaagaagcgagccaagaacccagtagct
cccacagagaacaacacttctgtggggccagtgtccaacctttgctcattgggagccaaa
gatctgctccatgcacctgaggaaggaccttttacattccctaatggggaggctgtggaa
catggtgaggagagtaaggatcggaccatcatgctgatgggagtgtcctcacagaagatt
tctcttcggctgaagagggctgttgcccacaaggccacccagactgaatcacagccttgg
attggcagtgagggcccttcaggtccctttgtgctgtcttccccaaggaagacagcccag
gatactctatatgtgcttcccagtcccacctctccatgtcctagcccagtcttggtcaga
aagcgggcttttgtcaagtgggagaataaagactccctcataaaatcaaaggaggagctc
cgtcacctcagactgcctacctaccaagaactggaacaggaaataaatactctgaaagca
gataatgatgccctaaagatccaactgaaatatgcacagaagaaaatagaatccctccag
cttgaaaaaagcaatcatgtcttagctcaaatggagcagggtgactgttcttag

DBGET integrated database retrieval system