KEGG   Homo sapiens (human): 10125Help
Entry
10125             CDS       T01001                                 

Gene name
RASGRP1, CALDAG-GEFI, CALDAG-GEFII, RASGRP, V, hRasGRP1
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04611  Platelet activation
hsa04660  T cell receptor signaling pathway
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10125 (RASGRP1)
   04010 MAPK signaling pathway
    10125 (RASGRP1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10125 (RASGRP1)
   04660 T cell receptor signaling pathway
    10125 (RASGRP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10125 (RASGRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 RasGEF_N EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Cep57_CLD_2 bZIP_1 DivIC
Motif
Other DBs
NCBI-GeneID: 10125
NCBI-ProteinID: NP_005730
OMIM: 603962
HGNC: 9878
Ensembl: ENSG00000172575
Vega: OTTHUMG00000172379
Pharos: O95267(Tchem)
UniProt: O95267 B2RA89
Structure
PDB: 

Position
15q14
AA seq 797 aa AA seqDB search
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG
LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA
PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI
SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR
KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ
LEKSNHVLAQMEQGDCS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgggcaaggcgagagaggctccgcggaaaccttcccatggctgcagagct
gcctctaaagcaagactagaggcaaagccagccaacagccccttcccctcccatcccagc
ttggcccacatcacccagttccgaatgatggtgtctctgggacatttagccaaaggagcc
agcctggacgatctcattgacagctgcattcaatcttttgatgcagatggaaacctgtgt
cgaagtaaccaactgttgcaagtcatgctgaccatgcaccgaattgtcatctcctctgca
gaactgctccaaaaagttatcaccctctataaggatgctttggcaaagaattcaccagga
ctttgcctgaagatctgttattttgtaaggtattggataacagaattctgggtcatgttt
aaaatggacgccagcttgacagacactatggaggagtttcaggaactggtgaaagctaag
ggtgaggagttacattgccgcctgattgacacaactcaaatcaatgcccgtgactggtcc
aggaaacttactcaaaggataaaatcaaataccagcaagaaacggaaagtctccctgctc
tttgaccatctggaaccagaagagctatccgagcacctcacctaccttgagttcaagtct
ttccggaggatatcgttctctgattatcagaattaccttgtaaatagctgtgtgaaggaa
aaccccaccatggagcgatctattgctctgtgcaacggcatctcccagtgggtacaactg
atggttctcagccgccccacgccgcagctccgagcagaagtcttcatcaagttcatccag
gtggctcagaagctccaccaactacagaacttcaatacactgatggctgtgataggtggg
ctgtgtcacagctcaatctcgaggctcaaggagacaagttcgcatgtcccacatgaaatc
aataaggttctcggtgagatgactgagctgctgtcctcctccagaaactacgacaattac
cggcgagcctatggagagtgcaccgacttcaagatccccattctgggtgtgcatctcaag
gacctcatctccctgtatgaagccatgcctgactatctggaggacgggaaagtgaacgtc
cataagctactggccctatacaatcatatcagtgaattggtccagctgcaagaggtggcc
ccacccttggaggctaacaaggacttggtacacttgctgacgttatccctggatctttac
tacactgaggatgaaatctatgagctttcctatgcccgggaaccaaggaaccacagagct
ccaccactaacaccttcaaagccaccagtagtagtggactgggcttctggagtgtctccc
aaacctgatccaaaaaccattagcaaacacgtccagaggatggtggattctgtcttcaag
aactatgatcacgaccaggatggatacatttctcaggaagaatttgaaaagattgctgcg
agttttccattttccttctgtgtgatggacaaagacagggaaggcctcatcagcagggat
gagatcacagcctacttcatgagagccagctcaatctattccaagctgggcctgggcttt
cctcacaacttccaagagaccacctacctgaagcccactttttgtgacaactgtgctgga
tttctctggggagtgatcaaacaaggatatcgatgtaaagactgcgggatgaactgtcac
aaacaatgcaaagatctggttgtgtttgagtgtaagaagcgagccaagaacccagtagct
cccacagagaacaacacttctgtggggccagtgtccaacctttgctcattgggagccaaa
gatctgctccatgcacctgaggaaggaccttttacattccctaatggggaggctgtggaa
catggtgaggagagtaaggatcggaccatcatgctgatgggagtgtcctcacagaagatt
tctcttcggctgaagagggctgttgcccacaaggccacccagactgaatcacagccttgg
attggcagtgagggcccttcaggtccctttgtgctgtcttccccaaggaagacagcccag
gatactctatatgtgcttcccagtcccacctctccatgtcctagcccagtcttggtcaga
aagcgggcttttgtcaagtgggagaataaagactccctcataaaatcaaaggaggagctc
cgtcacctcagactgcctacctaccaagaactggaacaggaaataaatactctgaaagca
gataatgatgccctaaagatccaactgaaatatgcacagaagaaaatagaatccctccag
cttgaaaaaagcaatcatgtcttagctcaaatggagcagggtgactgttcttag

DBGET integrated database retrieval system