KEGG   Homo sapiens (human): 10126Help
Entry
10126             CDS       T01001                                 

Gene name
DNAL4, MRMV3, PIG27
Definition
(RefSeq) dynein axonemal light chain 4
  KO
K10412  dynein light chain 4, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington disease
Disease
H01287  Congenital mirror movements
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    10126 (DNAL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10126 (DNAL4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     10126 (DNAL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynein_light DUF3109 Ground-like
Motif
Other DBs
NCBI-GeneID: 10126
NCBI-ProteinID: NP_005731
OMIM: 610565
HGNC: 2955
Ensembl: ENSG00000100246
Vega: OTTHUMG00000151025
Pharos: O96015(Tdark)
UniProt: O96015
Position
22q13.1
AA seq 105 aa AA seqDB search
MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET
MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaacagaagggaagaaagatgaggctgattataagcgactgcagaccttccct
ctggtcaggcactcggacatgccagaggagatgcgcgtggagaccatggagctatgtgtc
acagcctgtgagaaattctccaacaacaacgagagcgccgccaagatgatcaaagagaca
atggacaagaagttcggctcctcctggcacgtggtgatcggcgagggctttgggtttgag
atcacccacgaggtgaagaacctcctctacctgtacttcgggggcaccctggctgtgtgc
gtctggaagtgctcctga

DBGET integrated database retrieval system