KEGG   Homo sapiens (human): 10130
Entry
10130             CDS       T01001                                 

Symbol
PDIA6, ERP5, P5, TXNDC7
Name
(RefSeq) protein disulfide isomerase family A member 6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10130 (PDIA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10130 (PDIA6)
   04131 Membrane trafficking [BR:hsa04131]
    10130 (PDIA6)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     10130 (PDIA6)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   10130 (PDIA6)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    10130 (PDIA6)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 Thioredoxin_7 OST3_OST6 Thioredoxin_8 Thioredoxin_9
Other DBs
NCBI-GeneID: 10130
NCBI-ProteinID: NP_005733
OMIM: 611099
HGNC: 30168
Ensembl: ENSG00000143870
Vega: OTTHUMG00000090479
Pharos: Q15084(Tbio)
UniProt: Q15084 A0A384NPU5
Structure
PDB: 
4EF0 4GWR 3VWW 3W8J 1X5D

Position
2p25.1
AA seq 440 aa
MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggctctcctggtgctcggtctggtgagctgtaccttctttctggcagtgaatggtctg
tattcctctagtgatgatgtgatcgaattaactccatcgaatttcaaccgagaagttatt
cagagtgatagtttgtggcttgtagaattctatgctccatggtgtggtcactgtcaaaga
ttaacaccagaatggaagaaagcagcaactgcattaaaagatgttgtcaaagttggtgca
gttgatgcagataagcatcattccctaggaggtcagtatggtgttcagggatttcctacc
attaagatttttggatccaacaaaaacagaccagaagattaccaaggtggcagaactggt
gaagccattgtagatgctgcgctgagtgctctgcgccagctcgtgaaggatcgcctcggg
ggacggagcggaggatacagttctggaaaacaaggcagaagtgatagttcaagtaagaag
gatgtgattgagctgacagacgacagctttgataagaatgttctggacagtgaagatgtt
tggatggttgagttctatgctccttggtgtggacactgcaaaaacctagagccagagtgg
gctgccgcagcttcagaagtaaaagagcagacgaaaggaaaagtgaaactggcagctgtg
gatgctacagtcaatcaggttctggcctcccgatacgggattagaggatttcctacaatc
aagatatttcagaaaggcgagtctcctgtggattatgacggtgggcggacaagatccgac
atcgtgtcccgggcccttgatttgttttctgataacgccccacctcctgagctgcttgag
attatcaacgaggacattgccaagaggacgtgtgaggagcaccagctctgtgttgtggct
gtgctgccccatatccttgatactggagctgcaggcagaaattcttatctggaagttctt
ctgaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtggacagaagctgga
gcccagtctgaacttgagaccgcgttggggattggagggtttgggtaccccgccatggcc
gccatcaatgcacgcaagatgaaatttgctctgctaaaaggctccttcagtgagcaaggc
atcaacgagtttctcagggagctctcttttgggcgtggctccacggcacctgtaggaggc
ggggctttccctaccatcgttgagagagagccttgggacggcagggatggcgagcttccc
gtggaggatgacattgacctcagtgatgtggagcttgatgacttagggaaagatgagttg
tga

KEGG   Homo sapiens (human): 10961
Entry
10961             CDS       T01001                                 

Symbol
ERP29, C12orf8, ERp28, ERp31, HEL-S-107, PDI-DB, PDIA9
Name
(RefSeq) endoplasmic reticulum protein 29
  KO
K09586  endoplasmic reticulum protein 29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10961 (ERP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10961 (ERP29)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    10961 (ERP29)
SSDB
Motif
Pfam: ERp29_N ERp29
Other DBs
NCBI-GeneID: 10961
NCBI-ProteinID: NP_006808
OMIM: 602287
HGNC: 13799
Ensembl: ENSG00000089248
Vega: OTTHUMG00000169637
Pharos: P30040(Tbio)
UniProt: P30040 V9HW71
Structure
PDB: 
5V8Z 2QC7 5V90

Position
12q24.13
AA seq 261 aa
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQAL
LKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgccgctgtgccccgcgccgcatttctctccccgctgcttccccttctcctgggc
ttcctgctcctctccgctccgcatggcggcagcggcctgcacaccaagggcgcccttccc
ctggatacggtcactttctacaaggtcattcccaaaagcaagttcgtcttggtgaagttc
gacacccagtacccctacggtgagaagcaggatgagttcaagcgtcttgctgaaaactcg
gcttccagcgatgatctcttggtggcagaggtggggatctcagattatggtgacaagctg
aacatggagctgagtgagaaatacaagctggacaaagagagctacccagtcttctacctc
ttccgggatggggactttgagaacccagtcccatacactggggcagttaaggttggagcc
atccagcgctggctgaaggggcaaggggtctacctaggtatgcctggttgcctgcctgta
tacgacgccctggccggggagttcatcagggcctctggtgtggaggcccgccaggccctc
ttgaagcaggggcaagataacctctcaagtgtgaaggagactcagaagaagtgggccgag
caatacctgaagatcatggggaagatcttagaccaaggggaggacttcccagcatcagag
atgacacggatcgccaggctgattgagaagaacaagatgagtgacgggaagaaggaggag
ctccagaagagcttaaacatcctgactgccttccagaagaagggggccgagaaagaggag
ctgtaa

KEGG   Homo sapiens (human): 5034
Entry
5034              CDS       T01001                                 

Symbol
P4HB, CLCRP1, DSI, ERBA2L, GIT, P4Hbeta, PDI, PDIA1, PHDB, PO4DB, PO4HB, PROHB
Name
(RefSeq) prolyl 4-hydroxylase subunit beta
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01572  Cole-Carpenter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5034 (P4HB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5034 (P4HB)
   04131 Membrane trafficking [BR:hsa04131]
    5034 (P4HB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5034 (P4HB)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     5034 (P4HB)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   5034 (P4HB)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    5034 (P4HB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   5034 (P4HB)
  Exosomal proteins of colorectal cancer cells
   5034 (P4HB)
  Exosomal proteins of bladder cancer cells
   5034 (P4HB)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 ERp29_N AhpC-TSA Thioredoxin_8 Redoxin HyaE Glycos_trans_3N
Other DBs
NCBI-GeneID: 5034
NCBI-ProteinID: NP_000909
OMIM: 176790
HGNC: 8548
Ensembl: ENSG00000185624
Vega: OTTHUMG00000150269
Pharos: P07237(Tbio)
UniProt: P07237 A0A024R8S5
Structure
PDB: 

Position
17q25.3
AA seq 508 aa
MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctgtgcctggccgtggccgccctggtgcgcgccgacgccccc
gaggaggaggaccacgtcctggtgctgcggaaaagcaacttcgcggaggcgctggcggcc
cacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctggcc
cctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcaggttggcc
aaggtggacgccacggaggagtctgacctggcccagcagtacggcgtgcgcggctatccc
accatcaagttcttcaggaatggagacacggcttcccccaaggaatatacagctggcaga
gaggctgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccaccaccctg
cctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcatcggcttc
ttcaaggacgtggagtcggactctgccaagcagtttttgcaggcagcagaggccatcgat
gacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctcgacaaa
gatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggggaggtc
accaaggagaacctgctggactttatcaaacacaaccagctgccccttgtcatcgagttc
accgagcagacagccccgaagatttttggaggtgaaatcaagactcacatcctgctgttc
ttgcccaagagtgtgtctgactatgacggcaaactgagcaacttcaaaacagcagccgag
agcttcaagggcaagatcctgttcatcttcatcgacagcgaccacaccgacaaccagcgc
atcctcgagttctttggcctgaagaaggaagagtgcccggccgtgcgcctcatcaccctg
gaggaggagatgaccaagtacaagcccgaatcggaggagctgacggcagagaggatcaca
gagttctgccaccgcttcctggagggcaaaatcaagccccacctgatgagccaggagctg
ccggaggactgggacaagcagcctgtcaaggtgcttgttgggaagaactttgaagacgtg
gcttttgatgagaaaaaaaacgtctttgtggagttctatgccccatggtgtggtcactgc
aaacagttggctcccatttgggataaactgggagagacgtacaaggaccatgagaacatc
gtcatcgccaagatggactcgactgccaacgaggtggaggccgtcaaagtgcacagcttc
cccacactcaagttctttcctgccagtgccgacaggacggtcattgattacaacggggaa
cgcacgctggatggttttaagaaattcctggagagcggtggccaggatggggcaggggat
gatgacgatctcgaggacctggaagaagcagaggagccagacatggaggaagacgatgat
cagaaagctgtgaaagatgaactgtaa

KEGG   Homo sapiens (human): 81567
Entry
81567             CDS       T01001                                 

Symbol
TXNDC5, ENDOPDI, ERP46, HCC-2, HCC2, PDIA15, STRF8, UNQ364
Name
(RefSeq) thioredoxin domain containing 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81567 (TXNDC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    81567 (TXNDC5)
   04131 Membrane trafficking [BR:hsa04131]
    81567 (TXNDC5)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   81567 (TXNDC5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    81567 (TXNDC5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_7 HyaE TraF UCH_1
Other DBs
NCBI-GeneID: 81567
NCBI-ProteinID: NP_110437
OMIM: 616412
HGNC: 21073
Ensembl: ENSG00000239264
Vega: OTTHUMG00000014216
Pharos: Q8NBS9(Tbio)
UniProt: Q8NBS9
Structure
PDB: 

Position
6p24.3
AA seq 432 aa
MPARPGRLLPLLARPAALTALLLLLLGHGGGGRWGARAQEAAAAAADGPPAADGEDGQDP
HSKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVD
CTAHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVE
PPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV
KIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETG
ATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTW
EELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSL
HRFVLSQAKDEL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgcccgcgcgcccaggacgcctcctcccgctgctggcccggccggcggccctgactgcg
ctgctgctgctgctgctgggccatggcggcggcgggcgctggggcgcccgggcccaggag
gcggcggcggcggcggcggacgggccccccgcggcagacggcgaggacggacaggacccg
cacagcaagcacctgtacacggccgacatgttcacgcacgggatccagagcgccgcgcac
ttcgtcatgttcttcgcgccctggtgtggacactgccagcggctgcagccgacttggaat
gacctgggagacaaatacaacagcatggaagatgccaaagtctatgtggctaaagtggac
tgcacggcccactccgacgtgtgctccgcccagggggtgcgaggataccccaccttaaag
cttttcaagccaggccaagaagctgtgaagtaccagggtcctcgggacttccagacactg
gaaaactggatgctgcagacactgaacgaggagccagtgacaccagagccggaagtggaa
ccgcccagtgcccccgagctcaagcaagggctgtatgagctctcagcaagcaactttgag
ctgcacgttgcacaaggcgaccactttatcaagttcttcgctccgtggtgtggtcactgc
aaagccctggctccaacctgggagcagctggctctgggccttgaacattccgaaactgtc
aagattggcaaggttgattgtacacagcactatgaactctgctccggaaaccaggttcgt
ggctatcccactcttctctggttccgagatgggaaaaaggtggatcagtacaagggaaag
cgggatttggagtcactgagggagtacgtggagtcgcagctgcagcgcacagagactgga
gcgacggagaccgtcacgccctcagaggccccggtgctggcagctgagcccgaggctgac
aagggcactgtgttggcactcactgaaaataacttcgatgacaccattgcagaaggaata
accttcatcaagttttatgctccatggtgtggtcattgtaagactctggctcctacttgg
gaggaactctctaaaaaggaattccctggtctggcgggggtcaagatcgccgaagtagac
tgcactgctgaacggaatatctgcagcaagtattcggtacgaggctaccccacgttattg
cttttccgaggagggaagaaagtcagtgagcacagtggaggcagagaccttgactcgtta
caccgctttgtcctgagccaagcgaaagacgaactttag

KEGG   Homo sapiens (human): 9601
Entry
9601              CDS       T01001                                 

Symbol
PDIA4, ERP70, ERP72, ERp-72
Name
(RefSeq) protein disulfide isomerase family A member 4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04918  Thyroid hormone synthesis
hsa05110  Vibrio cholerae infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9601 (PDIA4)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    9601 (PDIA4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    9601 (PDIA4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9601 (PDIA4)
   04131 Membrane trafficking [BR:hsa04131]
    9601 (PDIA4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     9601 (PDIA4)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   9601 (PDIA4)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    9601 (PDIA4)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 Calsequestrin AhpC-TSA TraF Thioredoxin_4
Other DBs
NCBI-GeneID: 9601
NCBI-ProteinID: NP_004902
HGNC: 30167
Ensembl: ENSG00000155660
Vega: OTTHUMG00000150248
Pharos: P13667(Tbio)
UniProt: P13667 A0A090N8Y2
Structure
PDB: 
3IDV

Position
7q36.1
AA seq 645 aa
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgaggccccggaaagccttcctgctcctgctgctcttggggctggtgcagctgctggcc
gtggcgggtgccgagggcccggacgaggattcttctaacagagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgatgaggaagaagacgacttggaagttaaggaa
gaaaatggagtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagac
acagtgctgctggagttttatgctccatggtgtggacattgcaagcagtttgctccggaa
tatgaaaaaattgccaacatattaaaggataaagatcctcccattcctgttgccaagatc
gatgcaacctcagcgtctgtgctggccagcaggtttgatgtgagtggctaccccaccatc
aagatccttaagaaggggcaggctgtagactacgagggctccagaacccaggaagaaatt
gttgccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgctt
gtgttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggag
ttttatgccccatggtgtggacactgcaagaaacttgcccccgagtatgagaaggccgcc
aaggagctcagcaagcgttctcctccaattcccctggcaaaggtcgacgccaccgcagaa
acagacctggccaagaggtttgatgtctctggctatcccaccctgaaaattttccgcaaa
ggaaggccttatgactacaacggcccacgagaaaaatatggaatcgttgattacatgatc
gagcagtccgggcctccctccaaggagattctgaccctgaagcaggtccaggagttcctg
aaggatggagacgatgtcatcatcatcggggtctttaagggggagagtgacccagcctac
cagcaataccaggatgccgctaacaacctgagagaagattacaaatttcaccacactttc
agcacagaaatagcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcct
gagaaattccagtccaagtatgagccccggagccacatgatggacgtccagggctccacc
caggactcggccatcaaggacttcgtgctgaagtacgccctgcccctggttggccaccgc
aaggtgtcaaacgatgctaagcgctacaccaggcgccccctggtggtcgtctactacagt
gtggacttcagctttgattacagagctgcaactcagttttggcggagcaaagtcctagag
gtggccaaggacttccctgagtacacctttgccattgcggacgaagaggactatgctggg
gaggtgaaggacctggggctcagcgagagtggggaggatgtcaatgccgccatcctggac
gagagtgggaagaagttcgccatggagccagaggagtttgactctgacaccctccgcgag
tttgtcactgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtgccc
aagaacaacaagggacccgtcaaggtcgtggtgggaaagacctttgactccattgtgatg
gaccccaagaaggacgtcctcatcgagttctacgcgccatggtgcgggcactgcaagcag
ctagagcccgtgtacaacagcctggccaagaagtacaagggccaaaagggcctggtcatc
gccaagatggacgccactgccaacgacgtccccagcgaccgctataaggtggagggcttc
cccaccatctacttcgcccccagtggggacaaaaagaacccagttaaatttgagggtgga
gacagagatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagcagg
accaaggaagagctttga

DBGET integrated database retrieval system