KEGG   Homo sapiens (human): 10131Help
Entry
10131             CDS       T01001                                 

Gene name
TRAP1, HSP_75, HSP75, HSP90L, TRAP-1
Definition
(RefSeq) TNF receptor associated protein 1
  KO
K09488  TNF receptor-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10131 (TRAP1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   10131 (TRAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-GeneID: 10131
NCBI-ProteinID: NP_057376
OMIM: 606219
HGNC: 16264
Ensembl: ENSG00000126602
Vega: OTTHUMG00000129427
Pharos: Q12931(Tchem)
UniProt: Q12931 A0A140VJY2
Structure
PDB: 

Position
16p13.3
AA seq 704 aa AA seqDB search
MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgagctgcgggcgctgctgctgtggggccgccgcctgcggcctttgctgcgg
gcgccggcgctggcggccgtgccgggaggaaaaccaattctgtgtcctcggaggaccaca
gcccagttgggccccaggcgaaacccagcctggagcttgcaggcaggacgactgttcagc
acgcagaccgccgaggacaaggaggaacccctgcactcgattatcagcagcacagagagc
gtgcagggttccacttccaaacatgagttccaggccgagacaaagaagcttttggacatt
gttgcccggtccctgtactcagaaaaagaggtgtttatacgggagctgatctccaatgcc
agcgatgccttggaaaaactgcgtcacaaactggtgtctgacggccaagcactgccagaa
atggagattcacttgcagaccaatgccgagaaaggcaccatcaccatccaggatactggt
atcgggatgacacaggaagagctggtgtccaacctggggacgattgccagatcggggtca
aaggccttcctggatgctctgcagaaccaggctgaggccagcagcaagatcatcggccag
tttggagtgggtttctactcagctttcatggtggctgacagagtggaggtctattcccgc
tcggcagccccggggagcctgggttaccagtggctttcagatggttctggagtgtttgaa
atcgccgaagcttcgggagttagaaccgggacaaaaatcatcatccacctgaaatccgac
tgcaaggagttttccagcgaggcccgggtgcgagatgtggtaacgaagtacagcaacttc
gtcagcttccccttgtacttgaatggaaggcggatgaacaccttgcaggccatctggatg
atggaccccaaggatgtccgtgagtggcaacatgaggagttctaccgctacgtcgcgcag
gctcacgacaagccccgctacaccctgcactataagacggacgcaccgctcaacatccgc
agcatcttctacgtgcccgacatgaaaccgtccatgtttgatgtgagccgggagctgggc
tccagcgttgcactgtacagccgcaaagtcctcatccagaccaaggccacggacatcctg
cccaagtggctgcgcttcatccgaggtgtggtggacagtgaggacattcccctgaacctc
agccgggagctgctgcaggagagcgcactcatcaggaaactccgggacgttttacagcag
aggctgatcaaattcttcattgaccagagtaaaaaagatgctgagaagtatgcaaagttt
tttgaagattacggcctgttcatgcgggagggcattgtgaccgccaccgagcaggaggtc
aaggaggacatagcaaagctgctgcgctacgagtcctcggcgctgccctccgggcagcta
accagcctctcagaatacgccagccgcatgcgggccggcacccgcaacatctactacctg
tgcgcccccaaccgtcacctggcagagcactcaccctactatgaggccatgaagaagaaa
gacacagaggttctcttctgctttgagcagtttgatgagctcaccctgctgcaccttcgt
gagtttgacaagaagaagctgatctctgtggagacggacatagtcgtggatcactacaag
gaggagaagtttgaggacaggtccccagccgccgagtgcctatcagagaaggagacggag
gagctcatggcctggatgagaaatgtgctggggtcgcgtgtcaccaacgtgaaggtgacc
ctccgactggacacccaccctgccatggtcaccgtgctggagatgggggctgcccgccac
ttcctgcgcatgcagcagctggccaagacccaggaggagcgcgcacagctcctgcagccc
acgctggagatcaaccccaggcacgcgctcatcaagaagctgaatcagctgcgcgcaagc
gagcctggcctggctcagctgctggtggatcagatatacgagaacgccatgattgctgct
ggacttgttgacgaccctagggccatggtgggccgcttgaatgagctgcttgtcaaggcc
ctggagcgacactga

DBGET integrated database retrieval system