KEGG   Homo sapiens (human): 10136Help
Entry
10136             CDS       T01001                                 

Gene name
CELA3A, ELA3, ELA3A
Definition
(RefSeq) chymotrypsin like elastase family member 3A
  KO
K01345  pancreatic endopeptidase E [EC:3.4.21.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    10136 (CELA3A)
   04974 Protein digestion and absorption
    10136 (CELA3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    10136 (CELA3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.70  pancreatic endopeptidase E
     10136 (CELA3A)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   10136 (CELA3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 10136
NCBI-ProteinID: NP_005738
HGNC: 15944
Ensembl: ENSG00000142789
Vega: OTTHUMG00000002755
Pharos: P09093(Tbio)
UniProt: P09093
Position
1p36.12
AA seq 270 aa AA seqDB search
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARL
PVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNFIWKPTVFTRVSAFIDWIEETIASH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccggctgctcagttccctcctccttgtggccgttgcctcaggctatggccca
ccttcctctcactcttccagccgcgttgtccatggtgaggatgcggtcccctacagctgg
ccctggcaggtttccctgcagtatgagaaaagtggaagcttctaccacacgtgtggcggt
agcctcatcgcccccgattgggttgtgactgccggccactgcatctcgagggatctgacc
taccaggtggtgttgggtgagtacaaccttgctgtgaaggagggccccgagcaggtgatc
cccatcaactctgaggagctgtttgtgcatccactctggaaccgctcgtgtgtggcctgt
ggcaatgacatcgccctcatcaagctctcacgcagcgcccagctgggagatgccgtccag
ctcgcctcactccctcccgctggtgacatccttcccaacaagacaccctgctacatcacc
ggctggggccgtctctataccaatgggccactcccagacaagctgcagcaggcccggctg
cccgtggtggactataagcactgctccaggtggaactggtggggttccaccgtgaagaaa
accatggtgtgtgctggagggtacatccgctccggctgcaacggtgactctggaggaccc
ctcaactgccccacagaggatggtggctggcaggtccacggtgtgaccagctttgtttct
gcctttggctgcaacttcatctggaagcccacggtgttcactcgagtctccgccttcatc
gactggattgaggagaccatagcaagccactag

DBGET integrated database retrieval system