KEGG   Homo sapiens (human): 10136
Entry
10136             CDS       T01001                                 

Gene name
CELA3A, ELA3, ELA3A
Definition
(RefSeq) chymotrypsin like elastase 3A
  KO
K01345  pancreatic endopeptidase E [EC:3.4.21.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    10136 (CELA3A)
   04974 Protein digestion and absorption
    10136 (CELA3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10136 (CELA3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.70  pancreatic endopeptidase E
     10136 (CELA3A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   10136 (CELA3A)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 10136
NCBI-ProteinID: NP_005738
OMIM: 618693
HGNC: 15944
Ensembl: ENSG00000142789
Vega: OTTHUMG00000002755
Pharos: P09093(Tbio)
UniProt: P09093
Position
1p36.12
AA seq 270 aa
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARL
PVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNFIWKPTVFTRVSAFIDWIEETIASH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgatgctccggctgctcagttccctcctccttgtggccgttgcctcaggctatggccca
ccttcctctcactcttccagccgcgttgtccatggtgaggatgcggtcccctacagctgg
ccctggcaggtttccctgcagtatgagaaaagtggaagcttctaccacacgtgtggcggt
agcctcatcgcccccgattgggttgtgactgccggccactgcatctcgagggatctgacc
taccaggtggtgttgggtgagtacaaccttgctgtgaaggagggccccgagcaggtgatc
cccatcaactctgaggagctgtttgtgcatccactctggaaccgctcgtgtgtggcctgt
ggcaatgacatcgccctcatcaagctctcacgcagcgcccagctgggagatgccgtccag
ctcgcctcactccctcccgctggtgacatccttcccaacaagacaccctgctacatcacc
ggctggggccgtctctataccaatgggccactcccagacaagctgcagcaggcccggctg
cccgtggtggactataagcactgctccaggtggaactggtggggttccaccgtgaagaaa
accatggtgtgtgctggagggtacatccgctccggctgcaacggtgactctggaggaccc
ctcaactgccccacagaggatggtggctggcaggtccacggtgtgaccagctttgtttct
gcctttggctgcaacttcatctggaagcccacggtgttcactcgagtctccgccttcatc
gactggattgaggagaccatagcaagccactag

KEGG   Homo sapiens (human): 23436
Entry
23436             CDS       T01001                                 

Gene name
CELA3B, CBPP, ELA3B
Definition
(RefSeq) chymotrypsin like elastase 3B
  KO
K01345  pancreatic endopeptidase E [EC:3.4.21.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    23436 (CELA3B)
   04974 Protein digestion and absorption
    23436 (CELA3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23436 (CELA3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.70  pancreatic endopeptidase E
     23436 (CELA3B)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   23436 (CELA3B)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 23436
NCBI-ProteinID: NP_031378
OMIM: 618694
HGNC: 15945
Ensembl: ENSG00000219073
Vega: OTTHUMG00000002758
Pharos: P08861(Tbio)
UniProt: P08861
Position
1p36.12
AA seq 270 aa
MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALL
PVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNTRRKPTVFTRVSAFIDWIEETIASH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgatgctccggctgctcagttccctcctccttgtggccgttgcctcaggctatggccca
ccttcctctcgcccttccagccgcgttgtcaatggtgaggatgcggtcccctacagctgg
ccctggcaggtttccctgcagtatgagaaaagcggaagcttctaccacacctgtggcggt
agcctcatcgcccccgactgggttgtgactgccggccactgcatctcgagctcccggacc
taccaggtggtgttgggcgagtacgaccgtgctgtgaaggagggccccgagcaggtgatc
cccatcaactctggggacctctttgtgcatccactctggaaccgctcgtgtgtggcctgt
ggcaatgacatcgccctcatcaagctctcacgcagcgcccagctgggagacgccgtccag
ctcgcctcactccctccggctggtgacatccttcccaacgagacaccctgctacatcacc
ggctggggccgtctctataccaacgggccactcccagacaagctgcaggaggccctgctg
ccggtggtggactatgaacactgctccaggtggaactggtggggttcctccgtgaagaag
accatggtgtgtgctggaggggacatccgctccggctgcaatggtgactctggaggaccc
ctcaactgccccacagaggatggtggctggcaggtccatggcgtgaccagctttgtttct
gcctttggctgcaacacccgcaggaagcccacggtgttcactcgagtctccgccttcatt
gactggattgaggagaccatagcaagccactag

KEGG   Homo sapiens (human): 51032
Entry
51032             CDS       T01001                                 

Gene name
CELA2B, ELA2B
Definition
(RefSeq) chymotrypsin like elastase 2B
  KO
K01346  pancreatic elastase II [EC:3.4.21.71]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    51032 (CELA2B)
   04974 Protein digestion and absorption
    51032 (CELA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    51032 (CELA2B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     51032 (CELA2B)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   51032 (CELA2B)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 51032
NCBI-ProteinID: NP_056933
OMIM: 609444
HGNC: 29995
Ensembl: ENSG00000215704
Vega: OTTHUMG00000002259
Pharos: P08218(Tdark)
UniProt: P08218 Q6ISP9
Position
1p36.21
AA seq 269 aa
MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGG
SLIANSWVLTAAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGQLLV
VDYATCSSSGWWGSTVKTNMICAGGDGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSV
LGCNYYYKPSIFTRVSNYNDWINSVIANN
NT seq 810 nt   +upstreamnt  +downstreamnt
atgattaggaccctgctgctgtccactttggtggctggagccctcagttgtggggtctcc
acttacgcgcctgatatgtctaggatgcttggaggtgaagaagcgaggcccaacagctgg
ccctggcaggtctccctgcagtacagctccaatggccagtggtaccacacctgcggaggg
tccctgatagccaacagctgggtcctgacggctgcccactgcatcagctcctccgggatc
taccgcgtgatgctgggccagcataacctctacgttgcagagtccggctcgctggccgtc
agtgtctctaagattgtggtgcacaaggactggaactccgaccaggtctccaaagggaac
gacattgccctgctcaaactggctaaccccgtctccctcaccgacaagatccagctggcc
tgcctccctcctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaacggggctctccctgatgacctgaagcagggccagttgctggtt
gtggactatgccacctgctccagctctggctggtggggcagcaccgtgaagacgaatatg
atctgtgctgggggtgatggcgtgatatgcacctgcaacggagactccggtgggccgctg
aactgtcaggcatctgacggccggtgggaggtgcatggcatcggcagcctcacgtcggtc
cttggttgcaactactactacaagccctccatcttcacgcgggtctccaactacaacgac
tggatcaattcggtgattgcaaataactaa

KEGG   Homo sapiens (human): 63036
Entry
63036             CDS       T01001                                 

Gene name
CELA2A, AOMS4, ELA2A, PE-1
Definition
(RefSeq) chymotrypsin like elastase 2A
  KO
K01346  pancreatic elastase II [EC:3.4.21.71]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Disease
H02384  Abdominal obesity-metabolic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    63036 (CELA2A)
   04974 Protein digestion and absorption
    63036 (CELA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    63036 (CELA2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.71  pancreatic elastase II
     63036 (CELA2A)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   63036 (CELA2A)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 63036
NCBI-ProteinID: NP_254275
OMIM: 609443
HGNC: 24609
Ensembl: ENSG00000142615
Vega: OTTHUMG00000002258
Pharos: P08217(Tdark)
UniProt: P08217
Position
1p36.21
AA seq 269 aa
MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGG
SLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLV
VDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSR
LGCNYYHKPSVFTRVSNYIDWINSVIANN
NT seq 810 nt   +upstreamnt  +downstreamnt
atgataaggacgctgctgctgtccactttggtggctggagccctcagttgtggggacccc
acttacccaccttatgtgactagggtggttggcggtgaagaagcgaggcccaacagctgg
ccctggcaggtctccctgcagtacagctccaatggcaagtggtaccacacctgcggaggg
tccctgatagccaacagctgggtcctgacggctgcccactgcatcagctcctccaggacc
taccgcgtggggctgggccggcacaacctctacgttgcggagtccggctcgctggcagtc
agtgtctctaagattgtggtgcacaaggactggaactccaaccaaatctccaaagggaac
gacattgccctgctcaaactggctaaccccgtctccctcaccgacaagatccagctggcc
tgcctccctcctgccggcaccattctacccaacaactacccctgctacgtcacgggctgg
ggaaggctgcagaccaacggggctgttcctgatgtcctgcagcagggccggttgctggtt
gtggactatgccacctgctccagctctgcctggtggggcagcagcgtgaaaaccagtatg
atctgtgctgggggtgatggcgtgatctccagctgcaacggagactctggcgggccactg
aactgtcaggcgtctgacggccggtggcaggtgcacggcatcgtcagcttcgggtctcgc
ctcggctgcaactactaccacaagccctccgtcttcacgcgggtctccaattacatcgac
tggatcaattcggtgattgcaaataactaa

DBGET integrated database retrieval system