KEGG   Homo sapiens (human): 10138
Entry
10138             CDS       T01001                                 

Gene name
YAF2
Definition
(RefSeq) YY1 associated factor 2
  KO
K11468  YY1-associated factor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10138 (YAF2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     10138 (YAF2)
SSDB
Motif
Pfam: YAF2_RYBP zf-RanBP PROCN C1_2 DUF460
Other DBs
NCBI-GeneID: 10138
NCBI-ProteinID: NP_005739
OMIM: 607534
HGNC: 17363
Ensembl: ENSG00000015153
Vega: OTTHUMG00000169380
Pharos: Q8IY57(Tbio)
UniProt: Q8IY57
Structure
PDB: 
2D9G

Position
12q12
AA seq 180 aa
MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLV
AQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTV
GDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggagacaagaagagccccaccaggccgaagcggcagccgaagccgtcctcggatgag
ggttactgggactgtagcgtctgcaccttccggaacagcgccgaggccttcaagtgcatg
atgtgcgatgtgcggaagggcacctccacccggaaacctcgacctgtctcccagttggtt
gcacagcaggttactcagcagtttgtgcctcctacacagtcaaagaaagagaaaaaagat
aaagtagaaaaagaaaaaagtgaaaaggaaacaactagcaaaaagaatagccataagaaa
accaggccaagattgaaaaatgtggatcggagtagtgctcagcatttggaagttactgtt
ggagatctgacagtcattattacagactttaaggagaaaacaaagtcaccgcctgcatct
agtgctgcttctgcagatcaacacagtcaaagcggctctagctctgataacacagagaga
ggaatgtccaggtcatcttcacccagaggagaagcctcatcattgaatggagaatctcat
taa

DBGET integrated database retrieval system