KEGG   Homo sapiens (human): 1014Help
Entry
1014              CDS       T01001                                 

Gene name
CDH16
Definition
(RefSeq) cadherin 16
  KO
K06810  cadherin 16, KSP-cadherin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1014 (CDH16)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1014 (CDH16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin
Motif
Other DBs
NCBI-GeneID: 1014
NCBI-ProteinID: NP_004053
OMIM: 603118
HGNC: 1755
Ensembl: ENSG00000166589
Vega: OTTHUMG00000137518
Pharos: O75309(Tbio)
UniProt: O75309
Position
16q22.1
AA seq 829 aa AA seqDB search
MVPAWLWLLCVSVPQALPKAQPAELSVEVPENYGGNFPLYLTKLPLPREGAEGQIVLSGD
SGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDEN
DQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMF
QLEPRLGALALSPKGSTSLDHALERTYQLLVQVKDMGDQASGHQATATVEVSIIESTWVS
LEPIHLAENLKVLYPHHMAQVHWSGGDVHYHLESHPPGPFEVNAEGNLYVTRELDREAQA
EYLLQVRAQNSHGEDYAAPLELHVLVMDENDNVPICPPRDPTVSIPELSPPGTEVTRLSA
EDADAPGSPNSHVVYQLLSPEPEDGVEGRAFQVDPTSGSVTLGVLPLRAGQNILLLVLAM
DLAGAEGGFSSTCEVEVAVTDINDHAPEFITSQIGPISLPEDVEPGTLVAMLTAIDADLE
PAFRLMDFAIERGDTEGTFGLDWEPDSGHVRLRLCKNLSYEAAPSHEVVVVVQSVAKLVG
PGPGPGATATVTVLVERVMPPPKLDQESYEASVPISAPAGSFLLTIQPSDPISRTLRFSL
VNDSEGWLCIEKFSGEVHTAQSLQGAQPGDTYTVLVEAQDTDEPRLSASAPLVIHFLKAP
PAPALTLAPVPSQYLCTPRQDHGLIVSGPSKDPDLASGHGPYSFTLGPNPTVQRDWRLQT
LNGSHAYLTLALHWVEPREHIIPVVVSHNAQMWQLLVRVIVCRCNVEGQCMRKVGRMKGM
PTKLSAVGILVGTLVAIGIFLILIFTHWTMSRKKDPDQPADSVPLKATV
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggtccctgcctggctgtggctgctttgtgtctccgtcccccaggctctccccaaggcc
cagcctgcagagctgtctgtggaagttccagaaaactatggtggaaatttccctttatac
ctgaccaagttgccgctgccccgtgagggggctgaaggccagatcgtgctgtcaggggac
tcaggcaaggcaactgagggcccatttgctatggatccagattctggcttcctgctggtg
accagggccctggaccgagaggagcaggcagagtaccagctacaggtcaccctggagatg
caggatggacatgtcttgtggggtccacagcctgtgcttgtgcacgtgaaggatgagaat
gaccaggtgccccatttctctcaagccatctacagagctcggctgagccggggtaccagg
cctggcatccccttcctcttccttgaggcttcagaccgggatgagccaggcacagccaac
tcggatcttcgattccacatcctgagccaggctccagcccagccttccccagacatgttc
cagctggagcctcggctgggggctctggccctcagccccaaggggagcaccagccttgac
cacgccctggagaggacctaccagctgttggtacaggtcaaggacatgggtgaccaggcc
tcaggccaccaggccactgccaccgtggaagtctccatcatagagagcacctgggtgtcc
ctagagcctatccacctggcagagaatctcaaagtcctatacccgcaccacatggcccag
gtacactggagtgggggtgatgtgcactatcacctggagagccatcccccgggacccttt
gaagtgaatgcagagggaaacctctacgtgaccagagagctggacagagaagcccaggct
gagtacctgctccaggtgcgggctcagaattcccatggcgaggactatgcggcccctctg
gagctgcacgtgctggtgatggatgagaatgacaacgtgcctatctgccctccccgtgac
cccacagtcagcatccctgagctcagtccaccaggtactgaagtgactagactgtcagca
gaggatgcagatgcccccggctcccccaattcccacgttgtgtatcagctcctgagccct
gagcctgaggatggggtagaggggagagccttccaggtggaccccacttcaggcagtgtg
acgctgggggtgctcccactccgagcaggccagaacatcctgcttctggtgctggccatg
gacctggcaggcgcagagggtggcttcagcagcacgtgtgaagtcgaagtcgcagtcaca
gatatcaatgatcacgcccctgagttcatcacttcccagattgggcctataagcctccct
gaggatgtggagcccgggactctggtggccatgctaacagccattgatgctgacctcgag
cccgccttccgcctcatggattttgccattgagaggggagacacagaagggacttttggc
ctggattgggagccagactctgggcatgttagactcagactctgcaagaacctcagttat
gaggcagctccaagtcatgaggtggtggtggtggtgcagagtgtggcgaagctggtgggg
ccaggcccaggccctggagccaccgccacggtgactgtgctagtggagagagtgatgcca
ccccccaagttggaccaggagagctacgaggccagtgtccccatcagtgccccagccggc
tctttcctgctgaccatccagccctccgaccccatcagccgaaccctcaggttctcccta
gtcaatgactcagagggctggctctgcattgagaaattctccggggaggtgcacaccgcc
cagtccctgcagggcgcccagcctggggacacctacacggtgcttgtggaggcccaggat
acagatgagccgagactgagcgcttctgcacccctggtgatccacttcctaaaggcccct
cctgccccagccctgactcttgcccctgtgccctcccaatacctctgcacaccccgccaa
gaccatggcttgatcgtgagtggacccagcaaggaccccgatctggccagtgggcacggt
ccctacagcttcacccttggtcccaaccccacggtgcaacgggattggcgcctccagact
ctcaatggttcccatgcctacctcaccttggccctgcattgggtggagccacgtgaacac
ataatccccgtggtggtcagccacaatgcccagatgtggcagctcctggttcgagtgatc
gtgtgtcgctgcaacgtggaggggcagtgcatgcgcaaggtgggccgcatgaagggcatg
cccacgaagctgtcggcagtgggcatccttgtaggcaccctggtagcaataggaatcttc
ctcatcctcattttcacccactggaccatgtcaaggaagaaggacccggatcaaccagca
gacagcgtgcccctgaaggcgactgtctga

DBGET integrated database retrieval system