KEGG   Homo sapiens (human): 10146Help
Entry
10146             CDS       T01001                                 

Gene name
G3BP1, G3BP, HDH-VIII
Definition
(RefSeq) G3BP stress granule assembly factor 1
  KO
K17265  Ras GTPase-activating protein-binding protein 1 [EC:3.6.4.12 3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10146 (G3BP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10146 (G3BP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     10146 (G3BP1)
    3.6.4.13  RNA helicase
     10146 (G3BP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     10146 (G3BP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10146 (G3BP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTF2 RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 10146
NCBI-ProteinID: NP_005745
OMIM: 608431
HGNC: 30292
Ensembl: ENSG00000145907
Vega: OTTHUMG00000130123
Pharos: Q13283(Tbio)
UniProt: Q13283 Q5U0Q1 Q6ZP53
Structure
PDB: 

Position
5q33.1
AA seq 466 aa AA seqDB search
MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKE
IHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSV
ANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVS
NDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQ
TVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRD
QRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFF
QSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAARE
GDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggagaagcctagtcccctgctggtcgggcgggaatttgtgagacagtattac
acactgctgaaccaggccccagacatgctgcatagattttatggaaagaactcttcttat
gtccatgggggattggattcaaatggaaagccagcagatgcagtctacggacagaaagaa
atccacaggaaagtgatgtcacaaaacttcaccaactgccacaccaagattcgccatgtt
gatgctcatgccacgctaaatgatggtgtggtagtccaggtgatggggcttctctctaac
aacaaccaggctttgaggagattcatgcaaacgtttgtccttgctcctgaggggtctgtt
gcaaataaattctatgttcacaatgatatcttcagataccaagatgaggtctttggtggg
tttgtcactgagcctcaggaggagtctgaagaagaagtagaggaacctgaagaaagacag
caaacacctgaggtggtacctgatgattctggaactttctatgatcaggcagttgtcagt
aatgacatggaagaacatttagaggagcctgttgctgaaccagagcctgatcctgaacca
gaaccagaacaagaacctgtatctgaaatccaagaggaaaagcctgagccagtattagaa
gaaactgcccctgaggatgctcagaagagttcttctccagcacctgcagacatagctcag
acagtacaggaagacttgaggacattttcttgggcatctgtgaccagtaagaatcttcca
cccagtggagctgttccagttactgggataccacctcatgttgttaaagtaccagcttca
cagccccgtccagagtctaagcctgaatctcagattccaccacaaagacctcagcgggat
caaagagtgcgagaacaacgaataaatattcctccccaaaggggacccagaccaatccgt
gaggctggtgagcaaggtgacattgaaccccgaagaatggtgagacaccctgacagtcac
caactcttcattggcaacctgcctcatgaagtggacaaatcagagcttaaagatttcttt
caaagttatggaaacgtggtggagttgcgcattaacagtggtgggaaattacccaatttt
ggttttgttgtgtttgatgattctgagcctgttcagaaagtccttagcaacaggcccatc
atgttcagaggtgaggtccgtctgaatgtcgaagagaagaagactcgagctgccagggaa
ggcgaccgacgagataatcgccttcggggacctggaggccctcgaggtgggctgggtggt
ggaatgagaggccctccccgtggaggcatggtgcagaaaccaggatttggagtgggaagg
gggcttgcgccacggcagtga

DBGET integrated database retrieval system