KEGG   Homo sapiens (human): 10152
Entry
10152             CDS       T01001                                 

Gene name
ABI2, ABI-2, ABI2B, AIP-1, AIP1, AblBP3, SSH3BP2, argBP1, argBPIA, argBPIB
Definition
(RefSeq) abl interactor 2
  KO
K05751  abl interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10152 (ABI2)
SSDB
Motif
Pfam: Abi_HHR SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 10152
NCBI-ProteinID: NP_001269854
OMIM: 606442
HGNC: 24011
Ensembl: ENSG00000138443
Vega: OTTHUMG00000132879
Pharos: Q9NYB9(Tbio)
UniProt: Q9NYB9 F8WAL6
Structure
PDB: 
3P8C 4N78 2ED0

Position
2q33.2
AA seq 513 aa
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS
VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQK
PPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRT
YSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSAS
APAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH
TPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYV
IKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggagctgcagatgctgctggaagaggaaatcccggggggccgccgggccctcttc
gacagctacacaaatctggaacgggtggccgattactgcgagaacaactacatacagtca
gcagataagcagagagccctagaagaaaccaaagcctacaccacccaatccttagcaagt
gttgcctatctgataaacaccttggccaacaatgtcctgcagatgctggatatccaggca
tcccagctacgaaggatggaatcttcaatcaatcatatttcacaaacagttgatattcat
aaagagaaagttgcaagaagagaaattggtattttgactaccaataaaaacacttcaagg
acacataagattattgctccagccaaccttgaacgaccagttcgttatattagaaaacct
attgactatacaattctagatgatattggacatggagtaaagtggttgcttagatttaag
gtgagtacccagaacatgaagatgggtgggctgccgcgtacaacacctccaactcagaag
ccccctagtccccctatgtcagggaaagggacacttgggcggcactccccctatcgcaca
ctggagccagtgcgtcctccagtggtaccaaatgattacgtacctagcccaacccgtaat
atggctccctcgcagcagagccctgtgaggacagcttctgtgaatcaaagaaatcgaact
tacagcagcagtgggagtagtggagggagccacccaagtagtcggagcagcagtcgagag
aacagtggaagtggtagtgtgggggttcctattgctgttcctactccatctcctcccagt
gtctttccagcccctgctggctctgctggcactcctccccttcctgctacttctgcatct
gcccctgctcctcttgttcctgctactgtcccttcctccactgccccagacgctgctgct
gggggtgcccagacccttgctgatggcttcacttctccaactccccctgttgtttcttcc
actccccctacaggtcatcctgtacagttctacagcatgaataggcctgcctctcgccat
actcccccaacaatagggggctcgttgccctatagacgccctccttccattacttcacaa
acaagccttcagaatcagatgaatggaggacctttttatagccagaatccagtttcagat
acaccacctccaccgccacctgtggaagaaccagtctttgatgagtctcccccacctcct
cctcctccagaagattacgaagaggaggaagctgctgtggttgagtatagtgatccttat
gctgaagaggacccaccgtgggctccacgttcttacttggaaaaggttgtggcaatttat
gactatacaaaagacaaggaagatgagctgtcctttcaggaaggagccattatttatgtc
atcaagaagaatgacgatggttggtatgagggagttatgaatggagtgactgggcttttt
cctgggaattacgttgagtctatcatgcattattctgagtaa

DBGET integrated database retrieval system