KEGG   Homo sapiens (human): 10156
Entry
10156             CDS       T01001                                 

Gene name
RASA4, CAPRI, GAPL
Definition
(RefSeq) RAS p21 protein activator 4
  KO
K17630  Ras GTPase-activating protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10156 (RASA4)
SSDB
Motif
Pfam: C2 RasGAP BTK PH
Other DBs
NCBI-GeneID: 10156
NCBI-ProteinID: NP_008920
OMIM: 607943
HGNC: 23181
Ensembl: ENSG00000105808
Vega: OTTHUMG00000150383
Pharos: O43374(Tbio)
UniProt: O43374
Position
7q22.1
AA seq 803 aa
MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEI
HLRLEVWPGARACRLRCSVLEARDLAPKDRNGTSDPFVRVRYKGRTRETSIVKKSCYPRW
NETFEFELQEGAMEALCVEAWDWDLVSRNDFLGKVVIDVQRLRVVQQEEGWFRLQPDQSK
SRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEVKLGMQGPGQLIPLIEETTST
ECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASKSMESFLKVAG
MQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL
GALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIM
SPKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLK
DFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEA
LSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGSHVMQVIYTDDAGRPQTAYLQCKCVNE
LNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEKTGQGCDKTRSRVTLQEWNDP
LDHDLEAQLIYRHLLGVEAMLWERHRELSGGAEAGTVPTSPGKVPEDSLARLLRVLQDLR
EAHSSSPAGSPPSEPNCLLELQT
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggccaagcgcagctcgctgtacatccgcatcgtggaggggaagaaccttcccgccaag
gacatcactggcagcagcgacccctactgcatcgtgaaggtggacaatgagcccatcatc
aggacagccacagtgtggaagaccctgtgccccttctggggtgaggagtaccaagtgcac
ctgccgcccaccttccacgctgtggctttctatgtcatggatgaggatgccctcagccgg
gacgacgttatcggaaaggtctgccttacaagggacaccatagcctctcaccctaagggt
ttcagcgggtgggcccacctgacggaggtcgaccccgatgaggaggtgcagggcgagatc
cacctgcggctggaagtgtggccaggggcccgggcctgccggctacgctgctctgtgctg
gaggccagggatctggccccaaaggaccgcaatggcacatctgaccccttcgtccgagtg
cgctacaagggccggacacgggagacctcgatcgtgaagaagtcatgctacccacgctgg
aatgagacgtttgaatttgagctgcaggagggggccatggaggcgctgtgcgtggaggcc
tgggactgggaccttgtcagccgaaacgacttcctgggcaaagtggtgattgatgtccag
agactgcgggtggtgcagcaggaggagggctggttccggctgcagcccgaccagtccaag
agccggcggcatgacgagggcaacctgggctccttgcagctggaggtgcggctgcgggac
gagacggtgctgccctccagctactaccagccactggtgcacctgctgtgccacgaggtc
aagctgggcatgcagggcccagggcagctgatcccactcatcgaggagacaaccagcacc
gagtgtcgccaggacgtggccacgaacctgctcaagctcttcctggggcaggggctggcc
aaggacttcctggacctgctcttccagctggagctgagtcgcaccagtgagaccaacacc
ctgttccggagcaactctctggcctcaaagtccatggagtcttttctgaaggtggccggg
atgcagtacctgcacggcgtcctgggccccatcatcaacaaggtgtttgaggagaagaag
tacgtggagctggaccccagcaaagtggaagttaaggatgtagggtgctccgggctgcac
cgcccgcagaccgaggccgaggtgctggagcagagcgcgcagacgctgcgcgcccacctg
ggggccctgctgagcgcgctcagccgctcggttcgcgcgtgccccgccgtggtgcgcgcc
accttccgccagctcttccggcgcgtgcgcgagcgcttccccggcgcccagcacgagaat
gtaccgttcatcgccgtcaccagcttcctgtgcctgcgcttcttctctcccgccatcatg
tcgcccaagctcttccacctgcgggagcgccacgcggacgcccgcaccagccgcaccctg
ctcctgttggccaaggcagtccagaacgtgggcaacatggacacgccggcttccagggcc
aaggaggcttggatggagccgctgcagcccaccgtgcgccagggcgtggcgcagctgaag
gacttcatcaccaagctcgtggacatcgaggagaaggacgagctggacctgcagcggacg
ctgagtttgcaggcgccacctgtgaaggaggggccactcttcatccacaggaccaagggc
aagggccccctcatgtcctcctccttcaagaagctctacttctccctcactaccgaggcc
ctcagcttcgcgaagacgcccagctccaagaaaagcgccctcatcaagttagccaacatc
cgggcagcggaaaaggttgaggaaaagagctttggcggctcgcacgtcatgcaggtcatc
tacacggacgacgccggcaggccccagactgcctacctgcagtgcaagtgtgtgaatgag
cttaaccagtggctgtctgcgctgcggaaggtgagcatcaacaacaccggactgctgggc
tcctaccaccctggcgtcttccgtggggacaagtggagctgctgccaccaaaaagagaag
acaggtcagggctgcgataagacccggtcacgggtgaccctgcaggagtggaatgaccct
cttgaccatgaccttgaggcccagctcatctaccggcacctgctgggcgtggaggccatg
ctgtgggagaggcaccgggagctgagcgggggcgcagaggcaggcacggtgcccacgagc
cctggcaaagtccccgaggactcattggcccggctgctccgggtgctgcaggacctccgc
gaggcccatagctccagcccggccggctccccaccctcagagcccaactgcctcctggag
ctgcagacgtga

DBGET integrated database retrieval system