KEGG   Homo sapiens (human): 10159
Entry
10159             CDS       T01001                                 

Symbol
ATP6AP2, APT6M8-9, ATP6IP2, ATP6M8-9, CDG2R, ELDF10, HT028, M8-9, MRXE, MRXSH, MSTP009, PRR, RENR, XMRE, XPDS
Name
(RefSeq) ATPase H+ transporting accessory protein 2
  KO
K19514  renin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Disease
H00119  Congenital disorders of glycosylation type II
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    10159 (ATP6AP2)
SSDB
Motif
Pfam: Renin_r Phosphodiest
Other DBs
NCBI-GeneID: 10159
NCBI-ProteinID: NP_005756
OMIM: 300556
HGNC: 18305
Ensembl: ENSG00000182220
Vega: OTTHUMG00000024103
Pharos: O75787(Tbio)
UniProt: O75787
Position
Xp11.4
AA seq 350 aa
MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSW
PGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEE
TPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVD
LLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYN
FEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctgtgtttgtcgtgctcctggcgttggtggcgggtgttttggggaacgagtttagt
atattaaaatcaccagggtctgttgttttccgaaatggaaattggcctataccaggagag
cggatcccagacgtggctgcattgtccatgggcttctctgtgaaagaagacctttcttgg
ccaggactcgcagtgggtaacctgtttcatcgtcctcgggctaccgtcatggtgatggtg
aagggagtgaacaaactggctctacccccaggcagtgtcatttcgtaccctttggagaat
gcagttccttttagtcttgacagtgttgcaaattccattcactccttattttctgaggaa
actcctgttgttttgcagttggctcccagtgaggaaagagtgtatatggtagggaaggca
aactcagtgtttgaagacctttcagtcaccttgcgccagctccgtaatcgcctgtttcaa
gaaaactctgttctcagttcactccccctcaattctctgagtaggaacaatgaagttgac
ctgctctttctttctgaactgcaagtgctacatgatatttcaagcttgctgtctcgtcat
aagcatctagccaaggatcattctcctgatttatattcactggagctggcaggtttggat
gaaattgggaagcgttatggggaagactctgaacaattcagagatgcttctaagatcctt
gttgacgctctgcaaaagtttgcagatgacatgtacagtctttatggtgggaatgcagtg
gtagagttagtcactgtcaagtcatttgacacctccctcattaggaagacaaggactatc
cttgaggcaaaacaagcgaagaacccagcaagtccctataaccttgcatataagtataat
tttgaatattccgtggttttcaacatggtactttggataatgatcgccttggccttggct
gtgattatcacctcttacaatatttggaacatggatcctggatatgatagcatcatttat
aggatgacaaaccagaagattcgaatggattga

DBGET integrated database retrieval system