KEGG   Homo sapiens (human): 10160Help
Entry
10160             CDS       T01001                                 

Gene name
FARP1, CDEP, FARP1-IT1, PLEKHC2, PPP1R75
Definition
(RefSeq) FERM, ARH/RhoGEF and pleckstrin domain protein 1
  KO
K17477  FERM, RhoGEF and pleckstrin domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10160 (FARP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10160 (FARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH FERM_C FA FERM_N FERM_M IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 10160
NCBI-ProteinID: NP_005757
OMIM: 602654
HGNC: 3591
Ensembl: ENSG00000152767
Vega: OTTHUMG00000017248
Pharos: Q9Y4F1(Tbio)
UniProt: Q9Y4F1 A0A2X0TVY0
Structure
PDB: 

Position
13q32.2
AA seq 1045 aa AA seqDB search
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFF
LFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSL
ERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFC
LFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERW
MEVIRSATSSASRPHVLSHKESLVY
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaatagagcagaggccgaccccaggatcacgactgggggccccggaaaattcg
gggatcagtaccttggaacgtggacagaagccgcccccaacaccttcaggaaaactcgtg
tccatcaaaatccagatgctggatgacacccaggaggcatttgaagttccacaaagagct
cctgggaaggtgctgctggatgcagtttgcaaccacctcaacctcgtggaaggtgactat
tttggcctcgagtttcctgatcacaaaaagatcacggtgtggctggatctcctaaaaccc
attgtgaaacagattagaaggccaaagcacgttgttgttaagtttgtggtgaaattcttt
ccgcctgaccacacacaactccaagaagaactcacaaggtacctgttcgcgctgcaggtg
aagcaggacttggctcaaggcaggttgacgtgtaatgacaccagcgcagctctcttgatt
tcacacattgtgcaatctgagattggggattttgatgaagccttggacagagagcactta
gcaaaaaataaatacatacctcagcaagacgcactagaggacaaaatcgtggaatttcac
cataaccacattggacaaacaccagcagaatcagatttccagctcctagagattgcccgt
cggctagagatgtatggaatccggttgcacccggccaaggacagggaaggcacgaagatc
aatctggccgttgccaacacgggaattctagtgtttcagggtttcactaagatcaatgcc
ttcaactgggccaaggtgcggaagctgagcttcaagaggaagcgctttctcatcaagctc
cggccagatgccaatagtgcgtaccaggataccttggaattcctgatggccagtcgggat
ttctgcaagtccttctggaaaatctgtgttgaacatcatgccttctttagactttttgaa
gagcccaaaccaaagcccaagcccgtcctctttagccgggggtcatcatttcggttcagt
ggtcggactcagaagcaggttctcgactatgttaaagaaggaggacataagaaggtgcag
tttgaaaggaagcacagcaagattcattctatccggagccttgcttcacagcctacagaa
ctgaattcggaagtgctggagcagtctcagcagagcaccagccttacatttggagaaggt
gccgaatctccagggggccagagctgccggcgaggaaaggaaccgaaggtttccgccggg
gagccggggtcgcacccgagccctgcgccgaggagaagccccgcgggtaacaagcaggcg
gacggagccgcctcggcgcccacggaggaagaggaggaggtcgttaaggataggacccag
cagagtaaacctcagcccccgcagccaagcacaggctccctgactggcagtcctcacctt
tccgagctgtctgtgaactcgcaggggggagtggcccctgccaacgtgaccttgtctccc
aacctgagccccgacaccaagcaggcctctcccttgatcagcccgctgctgaatgaccag
gcctgcccccggacggacgatgaggatgagggccggaggaagagattcccaactgataaa
gcgtacttcatagctaaggaagtgtctaccaccgagcgaacatatctgaaggatctcgaa
gttatcacttcgtggtttcagagcacagtgagcaaagaggacgccatgccggaagcactg
aaaagtctcatattcccgaattttgaacctttgcacaaatttcatactaattttctcaag
gaaattgagcaacgacttgccctgtgggaaggccgctcaaatgcccaaatcagagattac
caaagaatcggcgatgtcatgctgaagaacattcagggcatgaagcacctggcggctcac
ctgtggaagcacagcgaggccttggaggccctggagaatggaatcaagagctcccggcgg
ctggagaacttctgcagagactttgagctgcagaaggtgtgttacctaccgctcaacacc
ttcctcctgcggccactgcaccggctcatgcactacaagcaggtcctggagcggctgtgc
aaacaccacccgccgagccacgccgacttcagggactgccgagccgctttggcagagatc
acggagatggtggcacagctccacggtacgatgatcaagatggagaatttccagaagctg
cacgaactcaagaaagatttgattggcattgacaatcttgtggttccgggaagggagttc
atccgtctgggcagcctcagcaagctctcggggaaggggctccagcagcgcatgttcttc
ctgttcaacgacgtcctgctatacacgagccgggggctgacggcctccaatcagtttaaa
gtccacgggcagctcccgctctatggcatgacgattgaggagagcgaagacgagtggggg
gtgccccactgcctgaccctccggggccagcggcagtccatcatcgtggccgccagttct
cggtccgagatggagaagtgggttgaggacatccagatggccattgacctggcggagaag
agcagcagccccgcccctgagttcctggccagcagcccccctgacaacaagtcccctgat
gaagccaccgcggctgaccaggagtcagaggatgacctgagcgcctcgcgcacatcgctg
gagcgccaggccccgcaccgcggcaacacaatggtgcacgtgtgctggcaccgcaacacc
agcgtctccatggtggacttcagcatcgcagtggagaatcagttgtctggaaacctgctg
aggaaattcaaaaacagcaacgggtggcagaagctgtgggtggtgttcacaaacttctgc
ctgttcttctacaaatcacaccaggacaatcatccccttgccagcctgcctctgctcggc
tactcgctcaccatcccctctgagtccgagaacatccagaaagactacgtgttcaagctg
cacttcaagtcccacgtctactacttcagggcggaaagcgagtacacgttcgaaaggtgg
atggaagtgatccgcagtgccaccagctctgcctcgcgaccccacgtgttgagtcacaaa
gagtctcttgtgtattga

DBGET integrated database retrieval system