KEGG   Homo sapiens (human): 10163Help
Entry
10163             CDS       T01001                                 

Gene name
WASF2, IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Definition
(RefSeq) WAS protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10163 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10163 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10163 (WASF2)
 09160 Human Diseases
  09161 Cancers: Overview
   05231 Choline metabolism in cancer
    10163 (WASF2)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    10163 (WASF2)
   05131 Shigellosis
    10163 (WASF2)
   05100 Bacterial invasion of epithelial cells
    10163 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10163 (WASF2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10163 (WASF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 WASH_WAHD RasGAP
Motif
Other DBs
NCBI-GeneID: 10163
NCBI-ProteinID: NP_008921
OMIM: 605875
HGNC: 12733
Ensembl: ENSG00000158195
Vega: OTTHUMG00000003393
Pharos: Q9Y6W5(Tbio)
UniProt: Q9Y6W5
Position
1p36.11
AA seq 498 aa AA seqDB search
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaggttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagttccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagtggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccaccaggccctaaacccgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccacctccaccaccgcctgtagga
tttgggtctccagggacgcctccaccaccctcacccccatctttcccacctcaccctgat
tttgctgcccctccacctcctcctccaccaccagcagctgactacccaactctgccacca
cctcccttgtcccagccaacaggaggagcacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctataccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgccgtgagcgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgttgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgactcctctgaatttgatgaggacgactggtccgattaa

DBGET integrated database retrieval system