KEGG   Homo sapiens (human): 10172
Entry
10172             CDS       T01001                                 
Symbol
ZNF256, BMZF-3, BMZF3
Name
(RefSeq) zinc finger protein 256
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10172 (ZNF256)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10172 (ZNF256)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10172 (ZNF256)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf_UBZ C1_1 Zn-ribbon_8 C1_4 zf-met DUF6300
Other DBs
NCBI-GeneID: 10172
NCBI-ProteinID: NP_005764
OMIM: 606956
HGNC: 13049
Ensembl: ENSG00000152454
UniProt: Q9Y2P7
Position
19:complement(57940833..57947706)
AA seq 627 aa
MAAAELTAPAQGIVTFEDVAVYFSWKEWGLLDEAQKCLYHDVMLENLTLTTSLGGSGAGD
EEAPYQQSTSPQRVSQVRIPKALPSPQKTNPCEICGPVLRQILHLVEHQGTHHGQKLYTD
GACRKQLQFTAYLHQHQKQHVGQKHFRSNGGRDMFLSSCTFEVSGKPFTCKEVGKDFLVR
SRFLQQQAAHTRKKSNRTKSAVAFHSVKNHYNWGECVKAFSYKHVRVQHQGDLIRERSYM
CSECGKSFSTSCSLSDHLRVHTSEKPYTCGECGKSYRQSSSLITHRRIHTGVRPHQCDEC
GKLFNRKYDLLIHQRVHTGERPYKCSECGKSFSHSSSLITHQRIHTGMRPYECSECGKSF
IHSSSLITHQRVHTGTRPYMCSECGKSFSQSCHLIKHRRLHIGEGPYECSECGKLFTYRS
RFFQHQRVHTGVRSHECHECGKLFSRKFDLIVHERVHTGERPYECSECGKSFTCKSYLIS
HWKVHTGARPYECGECGKSFTHSSTLLQHQRVHTGERPYECNECGKFFSQSSSLIRHRRS
HTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGE
RPYECSDCGKFFTFNSNLLKHQNVHKG
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggcggcggccgagctgacggccccggcccagggcattgtgacctttgaggacgtggct
gtttacttctcctggaaggagtggggtcttcttgatgaggctcagaaatgcctgtaccac
gatgtgatgctggagaacttgacacttacaacctccctgggtggttctggagcaggggat
gaggaggcaccttatcagcagagcacttctccacagcgggtgtcacaggttaggattcct
aaggcccttccttctccccagaagaccaacccctgtgagatatgtggcccagtcttgaga
cagattttgcacttggttgaacaccaaggaacacaccatggtcagaaactgtatacagac
ggggcatgtaggaaacaattacaatttactgcataccttcatcagcaccagaagcagcat
gttggacagaaacacttcagaagcaatgggggcagagacatgtttttgagcagctgcaca
tttgaagtatctgggaagcccttcacttgcaaggaggttgggaaggatttcctggtgaga
tcaagatttcttcagcaacaggctgctcacaccagaaagaagtcaaacagaaccaagagt
gcagtggcctttcacagtgtaaaaaatcattacaactggggagaatgtgtgaaagctttc
agctacaaacatgtacgtgttcagcaccagggagacctcattagggaaagatcttacatg
tgcagtgaatgtgggaaatcttttagcacaagctgtagcctcagtgatcatttgagagtt
cacacttcagaaaagccttatacatgtggagaatgtgggaaatcctataggcaaagctct
agccttattacgcaccgaagaattcacactggagtaagacctcatcaatgtgatgaatgt
ggaaaattatttaacaggaagtatgaccttcttatacatcagagagttcatactggagaa
aggccttacaagtgcagtgaatgtgggaaatcctttagccatagctctagcctcattaca
caccagagaattcatactggaatgaggccttatgagtgcagtgaatgtgggaaatctttt
atccatagttctagccttattacacaccagagagttcacactggtacaaggccttatatg
tgcagtgaatgtgggaaatcctttagccagagctgtcacctcattaaacaccggagactt
cacattggagaagggccttatgagtgtagtgaatgtgggaaattgtttacttatagatct
cgtttcttccaacaccagagagttcatactggagtaagatctcatgaatgtcatgaatgt
ggaaaattatttagcaggaaatttgacctcattgtacatgagagagttcacacaggagaa
aggccatatgagtgcagtgaatgtggaaaatcctttacctgtaaatcctacctcatctca
cactggaaagttcatactggagcaaggccttatgaatgtggggagtgtgggaaatcattt
actcatagctctacgctccttcaacaccagagagttcacactggagaaaggccttatgag
tgcaatgaatgtgggaagttttttagccagagctccagcctcattagacataggagaagt
cacaccggagaaaggccttatgagtgcagtgagtgttggaaatcctttagtaaccactct
agcctcgttaaacaccgaagagttcataccggagaaaggccttatgaatgcagtgaatgt
ggaaaatcctttagccagagctctaacctcactaatcaccagcgaattcacagtggggaa
aggccttatgagtgtagtgactgtggaaaattttttaccttcaactccaacctcctaaaa
catcagaacgttcacaagggataa

DBGET integrated database retrieval system