KEGG   Homo sapiens (human): 10174Help
Entry
10174             CDS       T01001                                 

Gene name
SORBS3, SCAM-1, SCAM1, SH3D4
Definition
(RefSeq) sorbin and SH3 domain containing 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Motif
Other DBs
NCBI-GeneID: 10174
NCBI-ProteinID: NP_005766
OMIM: 610795
HGNC: 30907
Ensembl: ENSG00000120896
Vega: OTTHUMG00000131728
Pharos: O60504(Tbio)
UniProt: O60504
Structure
PDB: 

Position
8p21.3
AA seq 671 aa AA seqDB search
MQGPPRSLRAGLSLDDFIPGHLQSHIGSSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCN
GGYTPRRDASQHPDPAWYQTWPGPGSKPSASTKIPASQHTQNWSATWTKDSKRRDKRWVK
YEGIGPVDESGMPIAPRSSVDRPRDWYRRMFQQIHRKMPDLQLDWTFEEPPRDPRHLGAQ
QRPAHRPGPATSSSGRSWDHSEELPRSTFNYRPGAFSTVLQPSNQVLRRREKVDNVWTEE
SWNQFLQELETGQRPKKPLVDDPGEKPSQPIEVLLERELAELSAELDKDLRAIETRLPSP
KSSPAPRRAPEQRPPAGPASAWSSSYPHAPYLGSARSLSPHKMADGGSPFLGRRDFVYPS
STRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG
EHHGRLGIFPANYVEVLPADEIPKPIKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEH
ICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDGPQLPTSPRLTAAARSA
RHPSSPSALRSPADPIDLGGQTSPRRTGFSFPTQEPRPQTQNLGTPGPALSHSRGPSHPL
DLGTSSPNTSQIHWTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKF
GTFPGNYVAPV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcccaccccgcagcctccgcgctgggctcagcctggacgacttcatccctggc
cacctccagtcccacatagggtcttcctcccgggggacacgggtgcccgtgatccggaat
ggtggctccaacacccttaatttccagttccacgaccccgcgcccaggactgtgtgcaat
gggggctacacaccaagacgagatgcttcccagcacccggaccctgcgtggtatcagacc
tggccaggccctgggagcaagccctctgcaagcacaaagatccctgcctcccagcacacc
cagaactggtcagccacgtggaccaaggacagcaagcgtcgggacaagcgctgggtcaag
tacgagggaatcgggcccgtggacgagagcggcatgcccattgccccccgatccagcgtt
gacagacccagagactggtaccggagaatgttccagcagattcaccggaaaatgccagac
ttgcagctggactggaccttcgaggagccacccagagaccccaggcatctaggagcccag
caaagacctgcccacaggcccggcccggcaacatcttccagtggaagaagctgggaccac
tctgaagagttacctagaagcaccttcaactacagacctggagcattctccactgtgctg
cagccctcaaatcaggtgctcagacgccgggaaaaagtagacaatgtctggacggaagag
tcctggaaccagtttctgcaggaactagagactgggcagaggcccaagaaaccgctggtg
gacgaccctggtgagaagccctcccagcccattgaggtgctgctggagagagagctggcc
gagctgagcgccgagctggacaaggacctgcgggcaattgagacccgactgccgtccccc
aagagctcgccggcgccccgacgggccccggagcagcggcccccggccggcccggcctca
gcctggagctccagctacccacatgcaccttacctgggttccgcccggtccctgagtccc
cacaaaatggctgatggaggaagccccttcctaggtcggagggactttgtctacccttcc
tcaacccgagaccctagtgcctctaacggagggggcagcccagccaggagggaagagaag
aagagaaaggccgccaggctcaagtttgacttccaggcgcagtcccccaaggagctgact
ctgcagaagggtgacattgtctacatccacaaggaggtggacaagaactggctggaggga
gagcaccacggccgcctgggcatcttccctgctaattatgtggaggtgctgcccgcagat
gagatccctaagcccatcaagcccccgacctaccaggtgctggagtatggagaggctgtg
gcccagtacaccttcaagggggacctggaggtggagctgtccttccgcaagggagagcac
atctgcctgatccgcaaggtgaacgagaactggtacgagggacgcatcacgggcacgggg
cgccaaggcatattccctgccagctacgtgcaggtgtctcgtgaaccccggctccggctc
tgtgacgacggcccccagctccccacgtctccccgcctgaccgctgccgcccgctcagcc
cgtcaccccagctccccctcagccctgcgcagcccagctgaccccatcgacttgggggga
cagacctccccccgtcgcactggcttctccttccccacccaggagcctagaccccagacc
cagaatcttggcacccctggtccagctctgtcccactctcgaggtcccagccatcccctg
gacctggggacctcctctcctaacacctctcagatacactggaccccgtaccgggcgatg
taccagtacaggccccagaacgaagacgagctggagctgcgcgagggggacagggtggat
gtcatgcagcagtgtgacgatggctggtttgtgggtgtctcccggaggacccagaaattc
ggaacgttccctggaaattacgttgccccggtgtga

DBGET integrated database retrieval system