KEGG   Homo sapiens (human): 10175Help
Entry
10175             CDS       T01001                                 

Gene name
CNIH1, CNIH, CNIH-1, CNIL, TGAM77
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 1
  KO
K20368  protein cornichon
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10175 (CNIH1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10175 (CNIH1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    10175 (CNIH1)
Transporters [BR:hsa02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   10175 (CNIH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 10175
NCBI-ProteinID: NP_005767
OMIM: 611287
HGNC: 19431
Ensembl: ENSG00000100528
Vega: OTTHUMG00000152335
Pharos: O95406(Tbio)
UniProt: O95406 B2R4P1
Position
14q22.2
AA seq 144 aa AA seqDB search
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA
FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW
CKLAFYLLAFFYYLYGMIYVLVSS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacgttcgcggccttctgctacatgctggcgctgctgctcactgccgcgctc
atcttcttcgccatttggcacattatagcatttgatgagctgaagactgattacaagaat
cctatagaccagtgtaataccctgaatccccttgtactcccagagtacctcatccacgct
ttcttctgtgtcatgtttctttgtgcagcagagtggcttacactgggtctcaatatgccc
ctcttggcatatcatatttggaggtatatgagtagaccagtgatgagtggcccaggactc
tatgaccctacaaccatcatgaatgcagatattctagcatattgtcagaaggaaggatgg
tgcaaattagctttttatcttctagcatttttttactacctatatggcatgatctatgtt
ttggtgagctcttag

DBGET integrated database retrieval system