KEGG   Homo sapiens (human): 10179Help
Entry
10179             CDS       T01001                                 

Gene name
RBM7
Definition
(RefSeq) RNA binding motif protein 7
  KO
K13188  RNA-binding protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10179 (RBM7)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    10179 (RBM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_7
Motif
Other DBs
NCBI-GeneID: 10179
NCBI-ProteinID: NP_057174
OMIM: 612413
HGNC: 9904
Ensembl: ENSG00000076053
Vega: OTTHUMG00000168270
Pharos: Q9Y580(Tdark)
UniProt: Q9Y580
Structure
PDB: 

Position
11q23.2
AA seq 266 aa AA seqDB search
MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHE
VSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERT
MDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHS
FNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDR
NHDDWSHDYDNRRDSSRDGKWRSSRH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggcggcggcggaagcggatcgcactctctttgtgggcaaccttgaaacgaaa
gtgaccgaggagctccttttcgagcttttccaccaggctgggccagtaataaaggtgaaa
attccaaaagataaggatggtaaaccaaagcagtttgcgtttgtgaatttcaaacatgaa
gtgtctgttccttatgcaatgaatctacttaatggaatcaaactttatggaaggcctatc
aaaattcaatttagatcaggaagtagtcatgccccacaagatgtcagtttgtcatatccc
caacatcatgttggaaattcaagccctacctccacatctcctagcaggtacgaaaggact
atggataacatgacttcatcagcacagataattcagagatctttctcttctccagaaaat
tttcagagacaagcagtgatgaacagtgctttgagacaaatgtcatatggtggaaaattt
ggttcttcacctctggatcaatcaggattttcaccatcagttcaatcacacagtcatagt
ttcaatcagtcttcaagctcccagtggcgccaaggtacaccatcatcacagcgtaaagtc
agaatgaattcttatccctacctagcagatagacattatagccgggaacagcgttacact
gatcatgggtctgaccatcattacagaggaaagagagatgatttcttctatgaagacagg
aatcatgatgactggagccatgactatgataacagaagagacagtagtagagatggaaaa
tggcgctcatctcgacactaa

DBGET integrated database retrieval system