KEGG   Homo sapiens (human): 10180Help
Entry
10180             CDS       T01001                                 

Gene name
RBM6, 3G2, DEF-3, DEF3, HLC-11, NY-LU-12, g16
Definition
(RefSeq) RNA binding motif protein 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: OCRE G-patch RRM_1 Pentapeptide_4 zf-C2H2_jaz Inhibitor_I53
Motif
Other DBs
NCBI-GeneID: 10180
NCBI-ProteinID: NP_005768
OMIM: 606886
HGNC: 9903
Ensembl: ENSG00000004534
Vega: OTTHUMG00000156736
Pharos: P78332(Tbio)
UniProt: P78332 A8K6Q4
Position
3p21.31
AA seq 1123 aa AA seqDB search
MWGDSRPANRTGPFRGSQEERFAPGWNRDYPPPPLKSHAQERHSGNFPGRDSLPFDFQGH
SGPPFANVEEHSFSYGARDGPHGDYRGGEGPGHDFRGGDFSSSDFQSRDSSQLDFRGRDI
HSGDFRDREGPPMDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGT
YDLDFRGRDGSHADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGS
GTTDLDFRDRDTPHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPST
QDREHSGMNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADFQNS
QSPVQDQDKSQLSGREEQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFG
YGQSKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPEDATKEEILNAFRTPD
GMPVKNLQLKEYNTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIQDKEVTLEYVSSLDFW
YCKRCKANIGGHRSSCSFCKNPREVTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADK
EPEPRKREEGQESRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIML
KRIYRSTPPEVIVEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQ
NLDPPFSIDGKMVAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNR
QGQQSSSDCYIYDSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGK
SSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNP
LIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLC
RRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKL
QSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASS
EEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgtggggggattctcgacctgctaacagaactggaccttttcgtgggagccaagaagaa
aggtttgctcccgggtggaacagggattatcctcctcctccccttaagagtcatgctcaa
gagagacactctggcaactttcctggcagagattcacttccctttgatttccaggggcat
tcggggcctccttttgcaaatgtagaggagcattctttcagctatggagctagagacgga
ccgcatggtgactatcgaggaggggagggacctggacatgatttcagggggggagatttt
tcgtcttctgatttccagagcagagattcatcacagttggacttcaggggtagggacata
cattctggggattttcgggatagagaaggaccacctatggactataggggtggagatggt
acttctatggattatagaggtagggaggcacctcatatgaactacagagacagggatgct
cacgctgttgacttcagaggtagggatgctcctccatctgacttcaggggccggggcact
tatgatttagattttagaggccgggatggatcccatgcagattttaggggaagggattta
tcagatttggattttagggccagagaacagtcccgttctgattttaggaatagagatgta
tctgatttggactttagagacaaagacggaacacaagtagactttagaggccgaggttca
ggtactactgatctagactttagggacagggatacgccacattcagatttcagaggtaga
caccgatctaggactgatcaggattttaggggcagagagatgggatcttgtatggaattt
aaagatagggagatgccccctgtggatccaaatattttggattacattcagccctctaca
caagatagagaacattctggtatgaatgtgaacaggagagaagaatccacacatgaccat
acgatagaaaggcctgcttttggcattcagaagggagaatttgagcattcagaaacaaga
gaaggagaaacacaaggtgtagcctttgaacatgagtctccagcagactttcagaacagc
caaagtccagttcaagaccaagataagtcacagctttctggacgtgaagagcagagttca
gatgctggtctgtttaaagaagaaggcggtctggactttcttgggcggcaagacaccgat
tacagaagcatggagtaccgtgatgtggatcataggctgccaggaagccagatgtttggc
tatggccagagcaagtcttttccagagggcaaaactgcccgagatgcccaacgggacctt
caggatcaagattataggaccggcccaagtgaggagaaacccagcaggcttattcgatta
agtggggtacctgaagatgccacaaaagaagagattcttaatgcttttcggactcctgat
ggcatgcctgtaaagaacttgcagttgaaggagtataacacaggttacgactatggctat
gtctgcgtggagttttcactcttggaagatgccatcggatgcatggaggccaaccaggga
actctaatgatccaggacaaagaagttaccctggagtatgtatcaagcctggatttttgg
tactgcaaacgatgtaaggcaaacattggtgggcaccgatcttcctgttcattctgcaag
aacccaagagaagtgacagaggccaagcaagaattaataacctaccctcagcctcagaaa
acatccataccagcaccattggaaaaacagcccaaccagcccctaagaccagctgataag
gaacctgaacccaggaagagggaagaaggccaagagtcacgcttaggacatcaaaagaga
gaagcagaaaggtatctgcctccttctcgaagggaagggccaactttccgaagagaccga
gagagggagtcatggtctggagagacacgccaggatggagagagcaaaactatcatgcta
aagcgtatctatcgttccacaccacctgaggtgatagtggaagtgctggagccctatgtc
cgccttactactgccaacgtccgtatcatcaagaacagaacaggccctatggggcatacc
tatggctttattgacctcgactcccatgcggaagctcttcgtgtggtgaagatcttacag
aaccttgatccgccatttagcattgatgggaagatggtagctgtaaacctggccactgga
aaacgaagaaatgattctggggaccattctgaccacatgcattactatcagggtaaaaaa
tatttccgagataggaggggaggtggcagaaattcagactggtcttcagatacaaatcga
caaggacaacagtcatcatctgactgctacatatatgattctgctactggctactattat
gaccccttggcaggaacttattatgaccccaatacccagcaagaagtctatgtgccccag
gatcctggattacctgaggaagaagagatcaaggaaaaaaaacccaccagtcaaggaaag
tcaagtagcaagaaggaaatgtctaaaagagatggcaaggagaaaaaagacagaggagtg
acgaggtttcaggaaaatgccagtgaagggaaggcccctgcagaagacgtctttaagaag
cccctgcctcctactgtgaagaaggaagagagtccccctccacctaaagtggtaaaccca
ctgatcggcctcttgggtgaatatggaggagacagtgactatgaggaggaagaagaggag
gaacagacccctcccccacagccccgcacagcacagccccagaagcgagaggagcaaacc
aagaaggagaatgaagaagacaaactcactgactggaataaactggcttgtctgctttgc
agaaggcagtttcccaataaagaagttctgatcaaacaccagcagctgtcagacctgcac
aagcaaaacctggaaatccaccggaagataaaacagtctgagcaggagctagcctatctg
gaaaggagagaacgagagggaaagtttaaaggaagaggaaatgatcgcagggaaaagctc
cagtcttttgactctccagaaaggaaacggattaagtactccagggaaactgacagtgat
cgtaaacttgttgataaagaagatatcgacactagcagcaaaggaggctgtgtccaacag
gctactggctggaggaaagggacaggcctgggatatggccatcctggattggcttcatca
gaggaggctgaaggccggatgaggggccccagtgttggagcctcaggaagaaccagcaaa
agacagtccaacgagacttaccgagatgctgttcgaagagtcatgtttgctcgatataaa
gaactcgattaa

DBGET integrated database retrieval system