KEGG   Homo sapiens (human): 10181
Entry
10181             CDS       T01001                                 

Gene name
RBM5, G15, H37, LUCA-15, LUCA15, RMB5
Definition
(RefSeq) RNA binding motif protein 5
  KO
K13094  RNA-binding protein 5/10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10181 (RBM5)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    10181 (RBM5)
SSDB
Motif
Pfam: G-patch OCRE RRM_1 zf-RanBP G-patch_2 GSIII_N zf-C2H2
Other DBs
NCBI-GeneID: 10181
NCBI-ProteinID: NP_005769
OMIM: 606884
HGNC: 9902
Ensembl: ENSG00000003756
Vega: OTTHUMG00000156785
Pharos: P52756(Tbio)
UniProt: P52756 A0A024R2U6
Structure
PDB: 
5MFY 5MF9 2LKZ 2LK0 2LK1

Position
3p21.31
AA seq 815 aa
MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRGDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPPGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQILQSLHPP
LKIDGKTIGVDFAKSARKDLVLSDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGSVDYSY
LQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTS
NPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYYDPTTGLYY
DPNSQYYYNSLTQQYLYWDGEKETYVPAAESSSHQQSGLPPAKEGKEKKEKPKSKTAQQI
AKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQLIP
ELVRNGDEENPLKRGLVAAYSGDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNKD
ALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEP
KRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVRLK
GAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgggttcagacaaaagagtgagtagaacagagcgtagtggaagatacggttccatcata
gacagggatgaccgtgatgagcgtgaatcccgaagcaggcggagggactcagattacaaa
agatctagtgatgatcggaggggtgatagatatgatgactaccgagactatgacagtcca
gagagagagcgtgaaagaaggaacagtgaccgatccgaagatggctaccattcagatggt
gactatggtgagcacgactataggcatgacatcagtgacgagagggagagcaagaccatc
atgctgcgcggccttcccatcaccatcacagagagcgatattcgagaaatgatggagtcc
ttcgaaggccctcagcctgcggatgtgaggctgatgaagaggaaaacaggtgtaagccgt
ggtttcgccttcgtggagttttatcacttgcaagatgctaccagctggatggaagccaat
cagaaaaagttggtgattcaaggaaagcacattgcaatgcattatagcaatcccagacct
aagtttgaagattggctttgtaacaagtgctgccttaacaatttcaggaaaagactaaaa
tgcttccgatgtggagcagacaagtttgactctgaacaggaagtgcctcctggaaccaca
gagtcggttcagtctgtggattactactgtgatacgatcattcttcggaacatagctccg
cacactgtggtggattccatcatgacagcactgtctccttacgcgtctttagctgtcaat
aacatccgcctcataaaagacaaacagacccagcagaacagaggcttcgcatttgtgcag
ctgtcctctgcaatggatgcttctcagctgcttcagatattacagagtctccatcctcct
ttgaaaattgatggcaaaactattggggttgattttgcaaaaagtgccagaaaagacttg
gtcctctcagatggtaaccgcgtcagcgctttctctgtagctagtacggctattgctgct
gctcagtggtcatccacccagtctcaaagtggtgaaggaggcagtgttgactacagttat
ctgcaaccaggtcaagatggctatgcccaatatgctcagtattcacaggattatcagcag
ttttatcaacaacaagctggaggattggaatctgatgcatcatctgcatcaggcacagca
gtgaccaccacctcagcggctgtagtgtcccagagtcctcagctgtataatcaaacctcc
aatccacctggctctccgactgaggaagcacagcctagcactagcacaagtacacaggcc
ccagccgcttcccctactggtgtagttcctggtaccaaatatgcagtacctgacacgtcc
acttaccagtatgatgaatcttcaggatattactatgatccgacaacagggctctattat
gaccccaactcgcaatactactataattccttgacccagcagtacctttactgggatggg
gaaaaagagacctacgtgccagctgcagagtctagctcccaccagcagtcgggcctgcct
cctgcaaaagaggggaaagagaagaaggagaaacccaagagcaaaacagcccagcagatt
gccaaagacatggaacgctgggctaagagtttgaataagcagaaagaaaactttaaaaat
agctttcagcctgtcaattccttgagggaagaagaaaggagagaatctgctgcagcagac
gctggctttgctctctttgagaagaagggagccttagctgaaaggcagcagctcatccca
gaattggtgcgaaatggagatgaggagaatcccctcaaaaggggtctggttgctgcttac
agtggtgacagtgacaatgaggaggagctggtggagagacttgagagtgaggaagagaag
ctagctgactggaagaagatggcctgtctgctctgccggcgccagttcccgaacaaagat
gccctagtcaggcaccagcaactctcagaccttcacaagcaaaacatggacatctatcga
cgatccaggctgagcgagcaggagctggaagccttggagctaagggagagagagatgaaa
taccgagaccgagctgcagaaagacgggagaagtacggcattccagaacctccagagccc
aagcgcaagaagcagtttgatgccggcactgtgaattacgagcaacccaccaaagatggc
attgaccacagtaacattggcaacaagatgctgcaggccatgggctggcgggaaggctct
ggcttgggacgaaagtgtcaaggcattacggctcccattgaggctcaagttcggctaaag
ggagctggcctaggagccaaaggcagcgcatatggtttgtcgggcgccgattcctacaaa
gatgctgtccggaaagccatgtttgcccggttcactgagatggagtga

DBGET integrated database retrieval system