KEGG   Homo sapiens (human): 10190Help
Entry
10190             CDS       T01001                                 

Gene name
TXNDC9, APACD, PHLP3
Definition
(RefSeq) thioredoxin domain containing 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin DUF3619
Motif
Other DBs
NCBI-GeneID: 10190
NCBI-ProteinID: NP_005774
OMIM: 612564
HGNC: 24110
Ensembl: ENSG00000115514
Vega: OTTHUMG00000130641
Pharos: O14530(Tbio)
UniProt: O14530
Position
2q11.2
AA seq 226 aa AA seqDB search
MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQ
QKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLE
TKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLG
SSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgatgcatctgttgacatgttttccaaagtcctggagcatcagctgcttcag
actaccaaactggtggaagaacatttggattctgaaattcaaaaactggatcagatggat
gaggatgaattggaacgccttaaagaaaagagactccaggcactaaggaaagctcaacag
cagaaacaagaatggctttctaaaggacatggggaatacagagaaatccctagtgaaaga
gacttttttcaagaagtcaaggagagtgaaaatgtggtttgccatttctacagagactcc
acattcaggtgtaaaatactagacagacatctggcaatattgtccaagaaacacctcgag
accaaatttttgaagctgaatgtggaaaaagcacctttcctttgtgagagactgcatatc
aaagtcattcccacactagcactgctaaaagatgggaaaacacaagattatgttgttggg
tttactgacctaggaaatacagatgacttcaccacagaaactttagaatggaggctcggt
tcttctgacattcttaattacagtggaaatttaatggagccaccatttcagaaccaaaag
aaatttggaacaaacttcacaaagctggaaaagaaaactatccgaggaaagaaatatgat
tcagactctgatgatgattag

DBGET integrated database retrieval system