KEGG   Homo sapiens (human): 101929983Help
Entry
101929983         CDS       T01001                                 

Gene name
PRAMEF27
Definition
(RefSeq) PRAME family member 27
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 101929983
NCBI-ProteinID: NP_001287820
HGNC: 51234
Ensembl: ENSG00000274764
Pharos: A3QJZ7(Tdark)
UniProt: A3QJZ7
Position
1p36.21
AA seq 478 aa AA seqDB search
MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRCCEALKLMVQA
WPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVCPRRWKLQVLDLQDVCENFWMVWSE
AMARGSFLNAKRNKTPVQDCPRMRGQQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLHCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNAFSFCGNPISMATLENLLSHTIILKNLCVEVYPAPRE
SYGADGTLCWNRFAQIRAELMNRVRDLRHPKRIFFCIDNCPDCGNRSFYDLEADQYCC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagcatccggactccacccagactcctggagcttgcggggcggagcctgctg
agggaccaagccttggccatgtccaccctggaggagctgcccacagaacttttcccccca
ctgttcatggaggccttcagcaggagatgctgtgaggccctgaagctgatggtgcaggcc
tggcccttccgccgcctccctctgaggcctctgataaagatgccttgtctggaggccttc
caagctgtgctcgatgggcttgatgcactgcttacccaaggggtttgtcccaggaggtgg
aaacttcaagtgctggatttacaggatgtctgtgagaacttctggatggtttggtctgaa
gctatggcccgtgggtccttcctcaatgccaagaggaacaaaacaccagtgcaggactgt
ccaaggatgagaggacagcagcccttgactgtgttcgtagaactttggctcaagaacagg
actctggatgaatacctcacctacctccttctatgggtcaagcagaggaaagatttacta
cacctgtgctgtaagaagctgaaaattttgggaatgcccttccgcaatatcagaagcatc
ctgaaaatggtgaacctagactgtatccaggaggtggaagtgaattgcaagtgggtactg
cccatcctgacacagtttaccccatacctgggccacatgaggaatcttcagaagctcgtt
ctctctcacatggatgtctctcgctacgtttccccagagcagaagaaggagattgttacc
cagttcaccactcagttcctcaagctgcactgcctccaaaagctttatatgaactctgtt
tctttcctcgaaggccacctggaccagctgctcagctgtctgaagacctcgttaaaggtc
ctcacaataactaactgtgtgcttttggaatcagacttgaagcatctatcccagtgcccg
agtatcagtcaactaaagaccctggacctgagtggcatcagactgaccaattacagtctt
gtgcctctccaaattctcctagaaaaagttgcagccacccttgagtacttggatttagat
gactgtggcatcatagactcccaagtcaacgccatcctgcctgccctgagccgctgcttt
gagctcaatgccttcagcttctgtggaaatcccatctccatggccaccctggagaacctg
ctgagccacacaatcatactcaaaaacttatgcgtggaggtgtatcctgccccgcgggag
agttatggtgctgatggtactctctgctggaacagatttgctcaaattagggctgagctg
atgaacagagtgagggacttaaggcaccccaagaggatctttttctgtattgataactgc
cctgactgtggcaacaggtcattttatgacctggaggcagatcaatactgctgttga

DBGET integrated database retrieval system