KEGG   Homo sapiens (human): 10194Help
Entry
10194             CDS       T01001                                 

Gene name
TSHZ1, CAA, NY-CO-33, SDCCAG33, TSH1
Definition
(RefSeq) teashirt zinc finger homeobox 1
  KO
K09236  teashirt
Organism
hsa  Homo sapiens (human)
Disease
H02115  Congenital aural atresia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10194 (TSHZ1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Others
    10194 (TSHZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_3rep zf-met zf-C2H2_jaz DUF760 zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 10194
NCBI-ProteinID: NP_001295139
OMIM: 614427
HGNC: 10669
Ensembl: ENSG00000179981
Vega: OTTHUMG00000132859
Pharos: Q6ZSZ6(Tbio)
UniProt: Q6ZSZ6
Position
18q22.3
AA seq 1077 aa AA seqDB search
MPRRKQQAPRRSAAYVPEEELKAAEIDEEHVEDDGLSLDIQESEYMCNEETEIKEAQSYQ
NSPVSSATNQDAGYGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVY
ANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCS
SSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPSLFSTVQLYRQNNKLYGSVF
TGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNRDKDSEKTKRWSKPRKRSLMEMEGK
EDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKVPLKEPVPAITKLVPSTKKRALQDLA
PPCSPEPAGMAAEVALSESAKDQKAANPYVTPNNRYGYQNGASYTWQFEARKAQILKCME
CGSSHDTLQQLTAHMMVTGHFLKVTTSASKKGKQLVLDPVVEEKIQSIPLPPTTHTRLPA
SSIKKQPDSPAGSTTSEEKKEPEKEKPPVAGDAEKIKEESEDSLEKFEPSTLYPYLREED
LDDSPKGGLDILKSLENTVSTAISKAQNGAPSWGGYPSIHAAYQLPGTVKPLPAAVQSVQ
VQPSYAGGVKSLSSAEHNALLHSPGSLTPPPHKSNVSAMEELVEKVTGKVNIKKEERPPE
KEKSSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLK
AKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSKPVSPSLDPLAMLYKISNS
MLDKPVYPATPVKQADAIDRYYYENSDQPIDLTKSKNKPLVSSVADSVASPLRESALMDI
SDMVKNLTGRLTPKSSTPSTVSEKSDADGSSFEEALDELSPVHKRKGRQSNWNPQHLLIL
QAQFASSLRETTEGKYIMSDLGPQERVHISKFTGLSMTTISHWLANVKYQLRRTGGTKFL
KNLDTGHPVFFCNDCASQFRTASTYISHLETHLGFSLKDLSKLPLNQIQEQQNVSKVLTN
KTLGPLGATEEDLGSTFQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLIYVTELEKQ
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaggaagcagcaggccccccggcgctcggcagcttatgttcctgaggaagaa
ttgaaggcagcagaaatagatgaagagcacgtggaggatgacgggctgtctttggacatt
caggaaagtgagtacatgtgcaatgaagagacggagatcaaagaggcgcagagctaccag
aactccccagtcagctctgcgactaaccaggacgccggctacgggtcgcccttcagtgag
agcagcgaccagctagcccatttcaaaggctcttcctctcgagaagagaaggaggatccg
cagtgtcccgacagcgtctcgtacccccaggacagcctggcacagatcaaagctgtgtat
gcaaacttgttctccgagtcctgctggtccagcttagctctggatttaaagaagtcgggt
tccaccaccagcaccaacgatgccagccagaaggagagctccgcccccacccccacaccc
cccacctgccccgtcagcaccactggccccaccacgagcacgcccagcaccagctgcagc
tccagcaccagccacagcagtaccaccagtaccagcagcagctccgggtacgactggcac
caggctgcactggccaagacgctgcagcagacgtcctcgtatgggctgcttcctgagccc
agcctgttcagcaccgtgcagctctaccgccagaacaacaagctctacggctccgtcttc
acgggcgccagcaagttccggtgcaaagactgcagtgccgcgtacgacacgctggtggaa
ctgacggtgcacatgaacgagacaggccactaccgtgacgacaacagggacaaggactcc
gagaagaccaagaggtggtccaagcccaggaagcgctccctgatggagatggaggggaag
gaggatgcccagaaggtgctgaagtgcatgtactgtggacactcctttgagtccttgcag
gacctcagcgtccacatgatcaaaaccaagcattaccagaaagtgcctctgaaggagcca
gtgccagccatcaccaaactggtcccctccaccaaaaagcgggcgcttcaggacctggcg
cccccctgctcccctgagccagcaggaatggccgcagaggtggccctgagtgagtcagcc
aaggatcagaaagcagcgaacccgtacgtcacgcccaataaccgctatggctaccagaat
ggcgccagctacacctggcagtttgaggcccgcaaggcgcagatcctcaagtgcatggag
tgtggcagctcccacgacacgctgcagcagctcaccgcccacatgatggtcaccgggcac
ttcctgaaagtgaccacctcggcttctaagaagggcaagcagttggtgctggaccctgtg
gtggaagagaagatccagtccatcccactaccgcccaccacccacacgcggctgccggcc
tccagcatcaaaaagcagcccgactctcccgcggggtccacgacttctgaagaaaagaaa
gagccagagaaggagaagccgcctgtggctggcgacgcggagaagatcaaggaggagagt
gaggacagcttggagaaatttgagcccagcaccctgtacccgtacctgcgtgaggaggac
ctggacgacagccccaagggagggctggacattctcaagtccctggagaataccgtctcc
acggccattagcaaagctcagaatggtgcgccctcatggggtggctaccccagcatccat
gcagcctaccagctcccgggcaccgtgaagccactgccggcggccgtgcagagcgtgcag
gtgcagccgtcctatgctggcggcgtgaagtcgctgtcttccgccgagcacaacgccctc
ctgcactccccagggagcctcacgcccccaccgcacaagagcaacgtgtctgccatggag
gagctggtggagaaggtcacgggcaaggtcaacatcaagaaggaggagagaccccctgag
aaggagaagagctccctggccaaggctgcgtcccccatagcaaaagagaataaagatttc
ccgaaaacggaggaagtcagcggcaaaccacagaagaagggccctgaggccgagactggg
aaggccaaaaaggagggaccgctggacgttcacaccccaaatggcacagagcctctcaaa
gcaaaggtcaccaacggctgtaacaacctggggatcatcatggaccactcaccggagcct
tccttcatcaacccgctgagcgctttgcagtccatcatgaacacccacctgggcaaggtg
tccaagcccgtgagtccctcgctggacccgctggcgatgctgtacaagatcagcaacagc
atgctggacaagccggtgtaccccgccacccctgtgaagcaggccgatgccatcgaccgc
tactattatgaaaacagcgaccagcccattgacttaaccaagtccaagaacaagccgctg
gtgtccagcgtggctgattcggtggcatcacctctgcgggagagcgcactcatggacatc
tccgacatggtgaaaaacctcacaggccgcctgacgcccaagtcctccacgccctccaca
gtttcagagaagtccgatgctgatggcagcagctttgaggaggcgttggacgagctgtca
ccggtccacaagaggaagggccggcagtccaactggaacccgcagcaccttctcatcctg
caggcccagttcgcctcgagcttgcgggagaccacagagggcaagtacatcatgtcggac
ttgggcccgcaggagagggtgcacatctcgaagtttactgggctctccatgaccaccatc
agccactggctggccaatgtgaagtaccagttgaggaggacagggggaacgaaattccta
aagaacctggacacagggcatcctgttttcttttgcaacgattgtgcctctcagttcaga
actgcttctacatacataagtcatttggagacacacttgggcttcagcctgaaggatctc
tccaagctgccactcaatcagattcaagaacagcagaatgtttcgaaagtcctcaccaac
aaaactctgggcccactgggggccaccgaggaagacttgggctccacattccaatgtaag
ctctgcaaccggacttttgcgagcaagcacgcagtcaaactgcaccttagtaagacccac
ggcaagtctcccgaggaccacctgatctatgtgactgagttggagaaacagtag

DBGET integrated database retrieval system