KEGG   Homo sapiens (human): 10196Help
Entry
10196             CDS       T01001                                 

Gene name
PRMT3, HRMT1L3
Definition
(RefSeq) protein arginine methyltransferase 3
  KO
K11436  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10196 (PRMT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     10196 (PRMT3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     10196 (PRMT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PrmA Methyltransf_25 Methyltransf_9 Methyltransf_31 Methyltransf_11 Methyltransf_23 MTS Met_10 Methyltransf_18 zf-C2H2_2 Methyltransf_12 FtsJ PRMT5_C TehB PRMT5 Methyltransf_16 Methyltransf_32 CMAS Cons_hypoth95 PCMT
Motif
Other DBs
NCBI-GeneID: 10196
NCBI-ProteinID: NP_005779
OMIM: 603190
HGNC: 30163
Ensembl: ENSG00000185238
Vega: OTTHUMG00000166022
Pharos: O60678(Tchem)
UniProt: O60678
Structure
PDB: 

Position
11p15.1
AA seq 531 aa AA seqDB search
MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSA
EETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEY
LKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAR
EDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRT
ESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN
KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYP
DICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHW
KQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgttagcgtcaggcgctaccggcggccggggcgctgtggagaatgaggaggac
ctgccagaactgtcggacagcggggacgaggccgcctgggaggatgaggacgatgcagat
ctcccccacggcaagcagcagaccccctgcctgttctgtaacaggttattcacatctgct
gaagaaacattttcacactgtaagtctgagcatcagtttaatattgacagcatggttcat
aaacatggacttgaattttatggatacattaagctaataaattttattagacttaagaat
cctacagttgagtacatgaattccatatacaacccagtgccttgggagaaagaagagtat
ttgaagccagtattagaagatgaccttttacttcaatttgatgtagaagatctttatgaa
ccggtgtcagtacccttctcataccccaatggactcagtgaaaatacatctgttgttgaa
aaattgaaacatatggaagccagggcactgtctgctgaagccgcattggccagagcacgt
gaggatctgcaaaaaatgaaacaatttgctcaggattttgtgatgcacacagatgtcaga
acctgctcgtcatctactagtgtcattgcggacctccaggaggatgaggatggtgtttat
ttcagctcatacgggcattatgggatacatgaagaaatgctaaaggacaaaatacgaaca
gaaagctaccgagatttcatataccaaaatccacatatcttcaaagacaaggtagttttg
gatgttgggtgtggaactggaattctctctatgtttgctgctaaagctggggcgaagaag
gttcttggagttgatcaatctgaaatactttaccaggcaatggatattataagactaaat
aaacttgaagatactattacactaattaaaggaaagattgaagaagttcatcttcctgta
gaaaaagtagatgttatcatatctgagtggatgggctattttcttctgtttgagtctatg
ttagattctgtcctttatgcaaagaacaaatacttggcaaaaggaggctcggtctaccct
gacatttgcactatcagccttgtagcagtgagtgatgtgaataaacatgctgatagaatt
gctttttgggatgatgtctatggcttcaagatgtcctgcatgaagaaagcagttattcca
gaagctgttgtggaagttttagatccgaagactcttatttcagaaccttgtggtattaag
catatagattgccatacgacgtctatctcagatttggaattttcatcagattttaccctg
aaaatcacaaggacatccatgtgcacggcaattgctggctactttgatatatattttgag
aagaattgccacaacagggtcgtgttctctacgggccctcagagcaccaaaacacactgg
aaacaaacagtatttctactggaaaaaccattttcagttaaagcaggtgaagccttgaaa
ggaaaggtcacagttcacaagaataagaaagatccacgttctctcaccgtgaccctcacg
ttgaataattcaactcaaacttatggtctccagtga

DBGET integrated database retrieval system