KEGG   Homo sapiens (human): 10197Help
Entry
10197             CDS       T01001                                 

Gene name
PSME3, HEL-S-283, Ki, PA28-gamma, PA28G, PA28gamma, REG-GAMMA
Definition
(RefSeq) proteasome activator subunit 3
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
hsa05160  Hepatitis C
Network
nt06163  Hepatitis C virus (HCV)
nt06263  Hepatocellular carcinoma
  Element
N00530  HCV core to RXRA/LXRA-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    10197 (PSME3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    10197 (PSME3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    10197 (PSME3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    10197 (PSME3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10197 (PSME3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    10197 (PSME3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10197 (PSME3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA28_beta PA28_alpha TMF_TATA_bd
Motif
Other DBs
NCBI-GeneID: 10197
NCBI-ProteinID: NP_005780
OMIM: 605129
HGNC: 9570
Ensembl: ENSG00000131467
Vega: OTTHUMG00000180654
Pharos: P61289(Tbio)
UniProt: P61289 V9HWJ8
Position
17q21.31
AA seq 254 aa AA seqDB search
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
KIKRPRSSNAETLY
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgttgctgaaggtggatcaggaagtgaagctcaaggttgattctttcagggag
cggatcacaagtgaggcagaagacttggtggcaaattttttcccaaagaagttattagaa
cttgatagttttctgaaggaaccaatcttaaacatccatgacctaactcagatccactct
gacatgaatctcccagtccctgaccccattcttctcaccaatagccatgatggactggat
ggtcccacttataagaagcgaaggttggatgagtgtgaagaagccttccaaggaaccaag
gtgtttgtgatgcccaatgggatgctgaaaagcaaccagcagctggtggacattattgag
aaagtgaaacctgagatccggctgttgattgagaaatgtaacacggtcaaaatgtgggta
cagctcctgattcccaggatagaagatggaaacaactttggggtgtccattcaggaggaa
acagttgcagagctaagaactgttgagagtgaagctgcatcttatctggaccagatttct
agatattatattacaagagccaaattggtttctaaaatagctaaatatccccatgtggag
gactatcgccgcaccgtgacagagattgatgagaaagaatatatcagccttcggctcatc
atatcagagctgaggaatcaatatgtcactctacatgacatgatcctgaaaaatatcgag
aagatcaaacggccccggagcagcaatgcagagactctgtactga

DBGET integrated database retrieval system