KEGG   Homo sapiens (human): 1020Help
Entry
1020              CDS       T01001                                 

Gene name
CDK5, LIS7, PSSALRE
Definition
(RefSeq) cyclin dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa05010  Alzheimer disease
hsa05030  Cocaine addiction
Disease
H00268  Lissencephaly
Drug target
Dinaciclib: D09604
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1020 (CDK5)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    1020 (CDK5)
  09165 Substance dependence
   05030 Cocaine addiction
    1020 (CDK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1020 (CDK5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1020 (CDK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1020 (CDK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1020 (CDK5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    1020 (CDK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 1020
NCBI-ProteinID: NP_004926
OMIM: 123831
HGNC: 1774
Ensembl: ENSG00000164885
Vega: OTTHUMG00000158414
Pharos: Q00535(Tchem)
UniProt: Q00535 A0A090N7W4
Structure
PDB: 

Position
7q36.1
AA seq 292 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggaaaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggagactcatgagatcgtggctctgaaacgggtgaggctggatgacgat
gatgagggtgtgccgagttccgccctccgggagatctgcctactcaaggagctgaagcac
aagaacatcgtcaggcttcatgacgtcctgcacagcgacaagaagctgactttggttttt
gaattctgtgaccaggacctgaagaagtattttgacagttgcaatggtgacctcgatcct
gagattgtaaagtcattcctcttccagctactaaaagggctgggattctgtcatagccgc
aatgtgctacacagggacctgaagccccagaacctgctaataaacaggaatggggagctg
aaattggctgattttggcctggctcgagcctttgggattcccgtccgctgttactcagct
gaggtggtcacactgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggccaatgctgggcgg
cctctttttcccggcaatgatgtcgatgaccagttgaagaggatcttccgactgctgggg
acgcccaccgaggagcagtggccctctatgaccaagctgccagactataagccctatccg
atgtacccggccacaacatccctggtgaacgtcgtgcccaaactcaatgccacagggagg
gatctgctgcagaaccttctgaagtgtaaccctgtccagcgtatctcagcagaagaggcc
ctgcagcacccctacttctccgacttctgtccgccctag

DBGET integrated database retrieval system