KEGG   Homo sapiens (human): 1020Help
Entry
1020              CDS       T01001                                 

Gene name
CDK5, LIS7, PSSALRE
Definition
(RefSeq) cyclin dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa05010  Alzheimer's disease
hsa05030  Cocaine addiction
Disease
H00268  Lissencephaly (LIS)
Drug target
Dinaciclib: D09604
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1020 (CDK5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1020 (CDK5)
  Substance dependence
   05030 Cocaine addiction
    1020 (CDK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1020 (CDK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1020 (CDK5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    1020 (CDK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 1020
NCBI-ProteinID: NP_004926
OMIM: 123831
HGNC: 1774
Ensembl: ENSG00000164885
Vega: OTTHUMG00000158414
Pharos: Q00535(Tchem)
UniProt: Q00535 A0A090N7W4
Structure
PDB: 

Position
7q36.1
AA seq 292 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggaaaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggagactcatgagatcgtggctctgaaacgggtgaggctggatgacgat
gatgagggtgtgccgagttccgccctccgggagatctgcctactcaaggagctgaagcac
aagaacatcgtcaggcttcatgacgtcctgcacagcgacaagaagctgactttggttttt
gaattctgtgaccaggacctgaagaagtattttgacagttgcaatggtgacctcgatcct
gagattgtaaagtcattcctcttccagctactaaaagggctgggattctgtcatagccgc
aatgtgctacacagggacctgaagccccagaacctgctaataaacaggaatggggagctg
aaattggctgattttggcctggctcgagcctttgggattcccgtccgctgttactcagct
gaggtggtcacactgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatctttgcagagctggccaatgctgggcgg
cctctttttcccggcaatgatgtcgatgaccagttgaagaggatcttccgactgctgggg
acgcccaccgaggagcagtggccctctatgaccaagctgccagactataagccctatccg
atgtacccggccacaacatccctggtgaacgtcgtgcccaaactcaatgccacagggagg
gatctgctgcagaaccttctgaagtgtaaccctgtccagcgtatctcagcagaagaggcc
ctgcagcacccctacttctccgacttctgtccgccctag

DBGET integrated database retrieval system