KEGG   Homo sapiens (human): 10205
Entry
10205             CDS       T01001                                 

Gene name
MPZL2, DFNB111, EVA, EVA1
Definition
(RefSeq) myelin protein zero like 2
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 TMEM154 Syndecan DUF4381 ASFV_J13L EphA2_TM
Other DBs
NCBI-GeneID: 10205
NCBI-ProteinID: NP_005788
OMIM: 604873
HGNC: 3496
Ensembl: ENSG00000149573
Vega: OTTHUMG00000166967
Pharos: O60487(Tbio)
UniProt: O60487 A0A024R3K1
Position
11q23.3
AA seq 215 aa
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
YTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
KRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtatggcaagagctctactcgtgcggtgcttcttctccttggcatacagctcacagct
ctttggcctatagcagctgtggaaatttatacctcccgggtgctggaggctgttaatggg
acagatgctcggttaaaatgcactttctccagctttgcccctgtgggtgatgctctaaca
gtgacctggaattttcgtcctctagacgggggacctgagcagtttgtattctactaccac
atagatcccttccaacccatgagtgggcggtttaaggaccgggtgtcttgggatgggaat
cctgagcggtacgatgcctccatccttctctggaaactgcagttcgacgacaatgggaca
tacacctgccaggtgaagaacccacctgatgttgatggggtgataggggagatccggctc
agcgtcgtgcacactgtacgcttctctgagatccacttcctggctctggccattggctct
gcctgtgcactgatgatcataatagtaattgtagtggtcctcttccagcattaccggaaa
aagcgatgggccgaaagagctcataaagtggtggagataaaatcaaaagaagaggaaagg
ctcaaccaagagaaaaaggtctctgtttatttagaagacacagactaa

DBGET integrated database retrieval system