KEGG   Homo sapiens (human): 10206
Entry
10206             CDS       T01001                                 

Gene name
TRIM13, CAR, DLEU5, LEU5, RFP2, RNF77
Definition
(RefSeq) tripartite motif containing 13
  KO
K12003  tripartite motif-containing protein 13 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10206 (TRIM13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10206 (TRIM13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    10206 (TRIM13)
SSDB
Motif
Pfam: zf-RING_UBOX zf-C3HC4 zf-B_box zf-C3HC4_3 zf-RING_5 zf-RING_2 zf-C3HC4_4 zf-C3HC4_2 zf-RING_4 ATP-synt_E_2 BCCT
Other DBs
NCBI-GeneID: 10206
NCBI-ProteinID: NP_005789
OMIM: 605661
HGNC: 9976
Ensembl: ENSG00000204977
Vega: OTTHUMG00000016926
Pharos: O60858(Tbio)
UniProt: O60858 A0A024RDU3 L7MTJ6
Position
13q14.2
AA seq 407 aa
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKE
TSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATR
GEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD
KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK
DVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
QDTGTFISKIPWSFYKLFLLILLLGLVIVFGPTMFLEWSLFDDLATWKGCLSNFSSYLTK
TADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggagctgcttgaagaagatctcacatgccctatttgttgtagtctgtttgatgatcca
cgggttttgccttgctcccacaacttctgcaaaaaatgcttagaaggtatcttagaaggg
agtgtgcggaattccttgtggagaccagctccattcaagtgtcctacatgccgtaaggaa
acttcagctactggaattaatagcctgcaggttaattactccctgaagggtattgtggaa
aagtataacaagatcaagatctctcccaaaatgccagtatgcaaaggacacttggggcag
cctctcaacattttctgcctgactgatatgcagctgatttgtgggatctgtgctactcgt
ggggagcacaccaaacatgtcttctgttctattgaagatgcctatgctcaggaaagggat
gcctttgagtccctcttccagagctttgagacctggcgtcggggagatgctctttctcgc
ttggataccttggaaactagtaagaggaaatccctacagttactgactaaagattcagat
aaagtgaaggaattttttgagaagttacaacacacactggatcaaaagaagaatgaaatt
ctgtctgactttgagaccatgaaacttgctgttatgcaagcatatgacccagagatcaac
aaactcaacaccatcttgcaggagcaacggatggcctttaacattgctgaggctttcaaa
gatgtgtcagaacccattgtatttctgcaacagatgcaggagtttagagagaaaatcaaa
gtaatcaaggaaactcctttacctccctctaatttgcctgcaagccctttaatgaagaac
tttgataccagtcagtgggaagacataaaactagtcgatgtggataaactttctttgcct
caagacactggcacattcattagcaagattccctggagcttttataagttatttttgcta
atccttctgcttggccttgtcattgtctttggtcctaccatgttcctagaatggtcatta
tttgatgacctggcaacttggaaaggctgtctttcaaacttcagttcctatctgactaaa
acagccgatttcatagaacaatcagttttttactgggaacaggtgacagatgggtttttc
attttcaatgaaagattcaagaattttactttggtggtactgaacaatgtggcagaattt
gtgtgcaaatataaactattataa

DBGET integrated database retrieval system