KEGG   Homo sapiens (human): 10207Help
Entry
10207             CDS       T01001                                 

Gene name
PATJ, Cipp, INADL, InaD-like, hINADL
Definition
(RefSeq) PATJ, crumbs cell polarity complex component
  KO
K06092  InaD-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
N00193  HPV E6 to host-cell-protein inhibition
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    10207 (PATJ)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    10207 (PATJ)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    10207 (PATJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_2 L27_2 MPDZ_u10
Motif
Other DBs
NCBI-GeneID: 10207
NCBI-ProteinID: NP_001337074
OMIM: 603199
HGNC: 28881
Ensembl: ENSG00000132849
Vega: OTTHUMG00000008560
Pharos: Q8NI35(Tbio)
Structure
PDB: 

Position
1p31.3
AA seq 1882 aa AA seqDB search
MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQL
KGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFN
SVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPET
VCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSL
FETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVA
VDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALF
LTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYE
VMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQP
EDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETE
VDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLV
ADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLVEDNEEE
SCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQ
QKEIEQSKEAWEMHEFLTPRLQEMDEEREMLVDEEYELYQDPSPSMELYPLSHIQEATPV
PSVNELHFGTQWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPS
TEGNSQQGRFDDLENLNSLAKTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQ
ATRVISKASAYTGMLSSRYATDTCELPEREEGEGEETPNFSHWGPPRIVEIFREPNVSLG
ISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSE
AVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMK
LPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRS
RMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIR
NEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQM
KQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEI
SKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEE
AITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFIS
DIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSWT
SARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEIN
RELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSH
ADVVNLLKNAYGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTETPPPKII
TLEKGSEGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAADDGRLKRGDQILAVNGETLEGV
THEQAVAILKHQRGTVTLTVLS
NT seq 5649 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaatcctgctacagataaactgcaggtgctgcaggtacttgatcgcctgaaa
atgaaattgcaggagaagggtgacacgtcgcagaatgagaagttatctatgttttatgag
acactaaagagtcctctcttcaaccagatactcacacttcagcagtccatcaagcaactg
aagggtcaactcaaccatataccctcagattgttcagccaactttgatttttctaggaaa
ggtttgttagtgttcacagatggttccatcactaatggaaatgtccacaggccctctaat
aactcgactgtatctgggttatttccgtggaccccgaagttgggaaatgaagactttaac
tcagtcattcaacagatggctcagggccggcaaattgaatatatagatatagaacggcct
tcaactggaggccttggattcagtgtggtggccctcagaagtcaaaatctcggaaaagtt
gatatcttcgtgaaggatgtccagccagggagtgtagcagacagggatcaaagattaaag
gaaaatgatcaaatattggccattaatcacacgccattggatcagaacatttcccatcag
caagcaattgcattattacaacaaaccactggatctttgagactgattgtggccagggaa
ccagtccacacaaaaagcagtacttctagcagcctaaatgatacaactctgcctgaaaca
gtttgttggggccatgttgaagaggttgagctcattaatgatggctctggactaggtttt
ggaatagttggaggaaaaacaagtggcgtggttgtgaggactatagttcctggaggatta
gcagatcgagatggaagactccagacaggggaccacatcttgaagattggtggcacaaac
gtgcagggaatgaccagtgagcaagttgcacaagttctaaggaactgtgggaattcagtc
aggatgctcgttgctagagatccagctggtgacatttcagtcaccccccctgcccctgca
gccttacctgttgccctgcctactgtagccagcaagggccctggttctgacagttctctt
tttgaaacttataatgttgagcttgtgagaaaagatgggcagagtcttggaattagaatt
gttggctatgttggaacatctcatacaggggaagcttcagggatttatgtgaaaagtata
atacctggcagtgctgcgtaccacaatggccacattcaagtgaatgacaaaatagttgct
gtcgatggcgtgaacattcagggttttgccaaccatgatgttgttgaagtattacgaaat
gcagggcaggtggtacacctaaccctagttcgaaggaagacatcctcatctacttctcca
cttgaaccaccttcagacagaggaactgttgtagaaccactgaaaccaccagctctcttt
ctaactggagcagtggaaactgaaactaatgtggatggtgaagatgaggaaattaaagaa
agaattgatactttaaaaaatgacaacatacaagccttagaaaaattggaaaaagtccca
gactctccagaaaatgagctgaaatccagatgggaaaacctgttgggtcctgattatgaa
gtaatggttgctactttggacacacagattgcagatgatgctgagttacagaaatattca
aagctgctgcctattcacactctgaggcttggtgtggaagtggattcctttgatgggcac
cattatatttcttcaattgtttctggtggtcctgttgatacattgggtctcctacagcca
gaagatgagctgcttgaggtcaatggcatgcagctttatggaaaatctcgccgagaagca
gtctcctttcttaaagaagtgccacccccttttactttggtttgctgtcggaggttgttt
gatgatgaagcttctgtagatgaaccaaggcgcactgaaacctctcttcctgagacagag
gttgaccacaatatggatgtcaatactgaagaagatgatgatggggaattagcactgtgg
tcccctgaagtcaagattgttgaactagtaaaagattgtaaaggtttgggattcagcatt
ttggattaccaggaccctttagatcctacaagatcagtgattgtgatccgctccctggta
gcagatggtgtagcagaaagaagtgggggactattacctggagaccgcctggtctcagtc
aatgaatactgtttggacaacacctcacttgctgaagctgtggaaatattgaaagctgtg
ccaccaggcctagtacaccttggcatctgtaagcctttggtggaagataatgaagaagaa
agttgttatattttacattcaagcagtaatgaagacaagactgaattttcaggaacaatt
catgatataaattcatctttaatactcgaagcacccaagggatttagagatgaaccatat
tttaaagaagaacttgtggatgaaccatttctagatctgggaaagtctttccattcccaa
caaaaagagatagagcaaagcaaggaggcctgggagatgcatgaatttctgactcctaga
ttgcaggaaatggatgaagaaagagaaatgcttgttgatgaagaatatgagttatatcaa
gatccctcaccatccatggagttgtatcccttgtcgcacattcaagaggccactcctgtg
ccctctgtgaatgaacttcactttggtacacagtggttgcatgataatgaaccatccgag
tctcaagaggcaagaaccgggaggactgtctattcccaggaggcacagccgtatggctat
tgccctgaaaatgtgatgaaagaaaattttgtcatggagtccctaccatctgtaccatca
actgaaggaaacagtcaacaaggcagatttgacgacctggaaaatcttaattcattagca
aaaactagtctggatttaggcatgatcccgaatgatgtccaaggtcctagcttgctcatt
gaccttcctgttgtggctcaaaggagggagcaagaagatttgcctttatatcaacaccaa
gcgacacgagttatttccaaggcctcagcatacacaggaatgttgtcttctagatatgcc
actgatacatgtgagttacctgagagagaagaaggcgaaggagaagaaactccaaatttt
agccactggggtccaccgagaattgttgagatttttagagaacccaatgtgtctcttggg
atcagtattgttggtggacaaactgttataaaacgtctaaagaatggagaggagcttaaa
ggtatattcatcaaacaagttttagaagacagtccagcagggaagacgaacgcacttaaa
actggagataaaatacttgaggtgtctggagtagatttgcagaatgcctcacacagcgaa
gcagttgaggccattaagaatgcaggaaaccctgtggtgttcattgttcagagtttgtca
tccactccacgagtcattcctaacgtacataacaaggccaacaaaatcaccggtaaccag
aaccaggacacccaagaaaagaaagaaaagaggcaaggaactgctccaccgccaatgaaa
cttcctcctccttataaagctctgactgatgacagtgatgaaaatgaagaagaagatgcc
tttaccgaccaaaaaatcagacaaagatatgcagatctgcctggagaactgcacattatt
gaacttgaaaaagataagaatggacttggactcagccttgctggtaataaagaccgatca
cgcatgagcatatttgtggtgggaattaacccggaaggacctgctgccgcagatggacga
atgcgtattggagatgaactcttagagataaacaatcagattctgtatggaagaagtcac
caaaatgcatctgccattattaagactgccccatcaaaggtcaagctggttttcatcaga
aacgaggatgcagtcaatcagatggccgttactccctttccagtgccatcaagttctcca
tcttctattgaggatcagagcggcaccgaacctattagtagtgaggaagatggcagcgtc
gaagttggtattaaacaattgcctgaaagtgaaagcttcaaactggctgtcagccagatg
aaacagcaaaaatatccaacaaaagtctccttcagttcacaagagataccattagcacca
gcttcatcataccattcaacagatgcagacttcacaggctatggtggtttccaggctcct
ctgtcagtggaccccgcaacgtgtcccattgtccctggacaggaaatgattatagaaata
tccaagggacgttcagggcttggtctcagcattgtgggaggaaaagacacacccttgaat
gctatagttatccatgaagtctatgaagaaggggcagcagccagagatggaagactttgg
gctggtgaccagatattagaggttaatggggttgacctgaggaactccagccacgaagaa
gccatcacagccctgaggcagaccccccagaaggtgcggctggtggtgtatagagatgag
gcacactaccgggatgaggagaacttggagattttccctgtggatctgcagaagaaagct
ggccggggcctgggcctgagcatcgttgggaaacgaaatggaagcggagtgtttatttct
gacatcgtgaaaggcggagccgcagacctggatgggagattgattcagggagatcagatc
ttatctgtgaatggggaggacatgagaaatgcctcacaggagacagtggccaccatcctc
aagtgtgcacagggacttgtgcagctagagattggaagactccgagctggttcctggacc
tccgcaaggacgacatcacagaacagtcagggtagtcagcagagtgcacacagcagctgt
catccctccttcgctcctgtcatcactggcctgcaaaacctggttggcacaaaaagagtt
tcagatccttcccagaaaaattcaggcacagatatggaaccaaggactgttgagataaac
agggagctcagtgatgcccttggaatcagtattgctggaggaagaggaagtcccttagga
gatatccccgtatttattgccatgattcaggctagcggagtggccgcacggacacagaag
cttaaagttggagatcggattgtcagcattaacgggcaacctttggatgggctgtctcac
gcggatgtggttaatctgctgaagaacgcctacgggcgcattatcctgcaggttgtagca
gataccaatataagcgccatagcagctcagcttgaaaacatgtctacaggctaccacctt
ggttcgcccactgctgaacaccatccagaagacacagaaacacctccacctaagattatt
actttggagaaaggctctgaaggcttggggtttagtattgtagggggttatggaagtccc
catggagacctgccaatttatgtcaagactgtatttgcaaagggagcagctgcagatgac
ggccgattaaaacgaggggatcagattttagctgttaatggcgagaccctggaaggtgtt
actcatgagcaagcagtcgccattctaaaacaccagagagggactgtaaccttaactgtg
ctgtcatga

DBGET integrated database retrieval system