KEGG   Homo sapiens (human): 10207Help
Entry
10207             CDS       T01001                                 

Gene name
PATJ, Cipp, INADL, InaD-like, hINADL
Definition
(RefSeq) PATJ crumbs cell polarity complex component
  KO
K06092  InaD-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Network
nt06135  Cytoskeletal regulation (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00344  CRB3-Pals1-PATJ complex
N00345  HPV E6 to CRB3-Pals1-PATJ complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    10207 (PATJ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10207 (PATJ)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    10207 (PATJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2 MPDZ_u10
Motif
Other DBs
NCBI-GeneID: 10207
NCBI-ProteinID: NP_001337074
OMIM: 603199
HGNC: 28881
Ensembl: ENSG00000132849
Vega: OTTHUMG00000008560
Pharos: Q8NI35(Tbio)
Structure
PDB: 

Position
1p31.3
AA seq 1882 aa AA seqDB search
MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQL
KGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFN
SVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPET
VCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSL
FETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVA
VDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALF
LTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYE
VMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQP
EDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETE
VDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLV
ADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLVEDNEEE
SCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQ
QKEIEQSKEAWEMHEFLTPRLQEMDEEREILVDEEYELYQDPSPSMELYPLSHIQEATPV
PSVNELHFGTQWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPS
TEGNSQQGRFDDLENLNSLAKTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQ
ATRVISKASAYTGMLSSRYATDTCELPEREEGEGEETPNFSHWGPPRIVEIFREPNVSLG
ISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSE
AVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMK
LPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRS
RMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIR
NEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQM
KQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEI
SKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEE
AITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFIS
DIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSWT
SARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEIN
RELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSH
ADVVNLLKNAYGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTETPPPKII
TLEKGSEGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAADDGRLKRGDQILAVNGETLEGV
THEQAVAILKHQRGTVTLTVLS
NT seq 5649 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaatcctgctacagataaactgcaggtgctgcaggtacttgatcgcctgaaa
atgaaattgcaggagaagggtgacacgtcgcagaatgagaagttatctatgttttatgag
acactaaagagtcctctcttcaaccagatactcacacttcagcagtccatcaagcaactg
aagggtcaactcaaccatataccctcagattgttcagccaactttgatttttctaggaaa
ggtttgttagtgttcacagatggttccatcactaatggaaatgtccacaggccctctaat
aactcgactgtatctgggttatttccgtggaccccgaagttgggaaatgaagactttaac
tcagtcattcaacagatggctcagggccggcaaattgaatatatagatatagaacggcct
tcaactggaggccttggattcagtgtggtggccctcagaagtcaaaatctcggaaaagtt
gatatcttcgtgaaggatgtccagccagggagtgtagcagacagggatcaaagattaaag
gaaaatgatcaaatattggccattaatcacacgccattggatcagaacatttcccatcag
caagcaattgcattattacaacaaaccactggatctttgagactgattgtggccagggaa
ccagtccacacaaaaagcagtacttctagcagcctaaatgatacaactctgcctgaaaca
gtttgttggggccatgttgaagaggttgagctcattaatgatggctctggactaggtttt
ggaatagttggaggaaaaacaagtggcgtggttgtgaggactatagttcctggaggatta
gcagatcgagatggaagactccagacaggggaccacatcttgaagattggtggcacaaac
gtgcagggaatgaccagtgagcaagttgcacaagttctaaggaactgtgggaattcagtc
aggatgctcgttgctagagatccagctggtgacatttcagtcaccccccctgcccctgca
gccttacctgttgccctgcctactgtagccagcaagggccctggttctgacagttctctt
tttgaaacttataatgttgagcttgtgagaaaagatgggcagagtcttggaattagaatt
gttggctatgttggaacatctcatacaggggaagcttcagggatttatgtgaaaagtata
atacctggcagtgctgcgtaccacaatggccacattcaagtgaatgacaaaatagttgct
gtcgatggcgtgaacattcagggttttgccaaccatgatgttgttgaagtattacgaaat
gcagggcaggtggtacacctaaccctagttcgaaggaagacatcctcatctacttctcca
cttgaaccaccttcagacagaggaactgttgtagaaccactgaaaccaccagctctcttt
ctaactggagcagtggaaactgaaactaatgtggatggtgaagatgaggaaattaaagaa
agaattgatactttaaaaaatgacaacatacaagccttagaaaaattggaaaaagtccca
gactctccagaaaatgagctgaaatccagatgggaaaacctgttgggtcctgattatgaa
gtaatggttgctactttggacacacagattgcagatgatgctgagttacagaaatattca
aagctgctgcctattcacactctgaggcttggtgtggaagtggattcctttgatgggcac
cattatatttcttcaattgtttctggtggtcctgttgatacattgggtctcctacagcca
gaagatgagctgcttgaggtcaatggcatgcagctttatggaaaatctcgccgagaagca
gtctcctttcttaaagaagtgccacccccttttactttggtttgctgtcggaggttgttt
gatgatgaagcttctgtagatgaaccaaggcgcactgaaacctctcttcctgagacagag
gttgaccacaatatggatgtcaatactgaagaagatgatgatggggaattagcactgtgg
tcccctgaagtcaagattgttgaactagtaaaagattgtaaaggtttgggattcagcatt
ttggattaccaggaccctttagatcctacaagatcagtgattgtgatccgctccctggta
gcagatggtgtagcagaaagaagtgggggactattacctggagaccgcctggtctcagtc
aatgaatactgtttggacaacacctcacttgctgaagctgtggaaatattgaaagctgtg
ccaccaggcctagtacaccttggcatctgtaagcctttggtggaagataatgaagaagaa
agttgttatattttacattcaagcagtaatgaagacaagactgaattttcaggaacaatt
catgatataaattcatctttaatactcgaagcacccaagggatttagagatgaaccatat
tttaaagaagaacttgtggatgaaccatttctagatctgggaaagtctttccattcccaa
caaaaagagatagagcaaagcaaggaggcctgggagatgcatgaatttctgactcctaga
ttgcaggaaatggatgaagaaagagaaattcttgttgatgaagaatatgagttatatcaa
gatccctcaccatccatggagttgtatcccttgtcgcacattcaagaggccactcctgtg
ccctctgtgaatgaacttcactttggtacacagtggttgcatgataatgaaccatccgag
tctcaagaggcaagaaccgggaggactgtctattcccaggaggcacagccgtatggctat
tgccctgaaaatgtgatgaaagaaaattttgtcatggagtccctaccatctgtaccatca
actgaaggaaacagtcaacaaggcagatttgacgacctggaaaatcttaattcattagca
aaaactagtctggatttaggcatgatcccgaatgatgtccaaggtcctagcttgctcatt
gaccttcctgttgtggctcaaaggagggagcaagaagatttgcctttatatcaacaccaa
gcgacacgagttatttccaaggcctcagcatacacaggaatgttgtcttctagatatgcc
actgatacatgtgagttacctgagagagaagaaggcgaaggagaagaaactccaaatttt
agccactggggtccaccgagaattgttgagatttttagagaacccaatgtgtctcttggg
atcagtattgttggtggacaaactgttataaaacgtctaaagaatggagaggagcttaaa
ggtatattcatcaaacaagttttagaagacagtccagcagggaagacgaacgcacttaaa
actggagataaaatacttgaggtgtctggagtagatttgcagaatgcctcacacagcgaa
gcagttgaggccattaagaatgcaggaaaccctgtggtgttcattgttcagagtttgtca
tccactccacgagtcattcctaacgtacataacaaggccaacaaaatcaccggtaaccag
aaccaggacacccaagaaaagaaagaaaagaggcaaggaactgctccaccgccaatgaaa
cttcctcctccttataaagctctgactgatgacagtgatgaaaatgaagaagaagatgcc
tttaccgaccaaaaaatcagacaaagatatgcagatctgcctggagaactgcacattatt
gaacttgaaaaagataagaatggacttggactcagccttgctggtaataaagaccgatca
cgcatgagcatatttgtggtgggaattaacccggaaggacctgctgccgcagatggacga
atgcgtattggagatgaactcttagagataaacaatcagattctgtatggaagaagtcac
caaaatgcatctgccattattaagactgccccatcaaaggtcaagctggttttcatcaga
aacgaggatgcagtcaatcagatggccgttactccctttccagtgccatcaagttctcca
tcttctattgaggatcagagcggcaccgaacctattagtagtgaggaagatggcagcgtc
gaagttggtattaaacaattgcctgaaagtgaaagcttcaaactggctgtcagccagatg
aaacagcaaaaatatccaacaaaagtctccttcagttcacaagagataccattagcacca
gcttcatcataccattcaacagatgcagacttcacaggctatggtggtttccaggctcct
ctgtcagtggaccccgcaacgtgtcccattgtccctggacaggaaatgattatagaaata
tccaagggacgttcagggcttggtctcagcattgtgggaggaaaagacacacccttgaat
gctatagttatccatgaagtctatgaagaaggggcagcagccagagatggaagactttgg
gctggtgaccagatattagaggttaatggggttgacctgaggaactccagccacgaagaa
gccatcacagccctgaggcagaccccccagaaggtgcggctggtggtgtatagagatgag
gcacactaccgggatgaggagaacttggagattttccctgtggatctgcagaagaaagct
ggccggggcctgggcctgagcatcgttgggaaacgaaatggaagcggagtgtttatttct
gacatcgtgaaaggcggagccgcagacctggatgggagattgattcagggagatcagatc
ttatctgtgaatggggaggacatgagaaatgcctcacaggagacagtggccaccatcctc
aagtgtgcacagggacttgtgcagctagagattggaagactccgagctggttcctggacc
tccgcaaggacgacatcacagaacagtcagggtagtcagcagagtgcacacagcagctgt
catccctccttcgctcctgtcatcactggcctgcaaaacctggttggcacaaaaagagtt
tcagatccttcccagaaaaattcaggcacagatatggaaccaaggactgttgagataaac
agggagctcagtgatgcccttggaatcagtattgctggaggaagaggaagtcccttagga
gatatccccgtatttattgccatgattcaggctagcggagtggccgcacggacacagaag
cttaaagttggagatcggattgtcagcattaacgggcaacctttggatgggctgtctcac
gcggatgtggttaatctgctgaagaacgcctacgggcgcattatcctgcaggttgtagca
gataccaatataagcgccatagcagctcagcttgaaaacatgtctacaggctaccacctt
ggttcgcccactgctgaacaccatccagaagacacagaaacacctccacctaagattatt
actttggagaaaggctctgaaggcttggggtttagtattgtagggggttatggaagtccc
catggagacctgccaatttatgtcaagactgtatttgcaaagggagcagctgcagatgac
ggccgattaaaacgaggggatcagattttagctgttaatggcgagaccctggaaggtgtt
actcatgagcaagcagtcgccattctaaaacaccagagagggactgtaaccttaactgtg
ctgtcatga

DBGET integrated database retrieval system