KEGG   Homo sapiens (human): 10213
Entry
10213             CDS       T01001                                 

Gene name
PSMD14, PAD1, POH1, RPN11
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    10213 (PSMD14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10213 (PSMD14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10213 (PSMD14)
   05012 Parkinson disease
    10213 (PSMD14)
   05014 Amyotrophic lateral sclerosis
    10213 (PSMD14)
   05016 Huntington disease
    10213 (PSMD14)
   05017 Spinocerebellar ataxia
    10213 (PSMD14)
   05020 Prion disease
    10213 (PSMD14)
   05022 Pathways of neurodegeneration - multiple diseases
    10213 (PSMD14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10213 (PSMD14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10213 (PSMD14)
   03051 Proteasome [BR:hsa03051]
    10213 (PSMD14)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M67
   10213 (PSMD14)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    10213 (PSMD14)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     10213 (PSMD14)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Other DBs
NCBI-GeneID: 10213
NCBI-ProteinID: NP_005796
OMIM: 607173
HGNC: 16889
Ensembl: ENSG00000115233
Vega: OTTHUMG00000153882
Pharos: O00487(Tbio)
UniProt: O00487 A0A140VKF2
Structure
PDB: 

Position
2q24.2
AA seq 310 aa
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacctaca
gatgctcctgcagtggacacagcagaacaagtctatatctcttccctggcactgttaaaa
atgttaaaacatggccgtgctggagttccaatggaagttatgggtttgatgcttggagaa
tttgttgatgattataccgtcagagtgattgatgtgtttgctatgccacagtcaggaaca
ggtgtcagtgtggaggcagttgatccagtgttccaagctaaaatgttggatatgttgaag
cagacaggaaggccggagatggttgttggttggtatcacagtcaccctggctttggttgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacttcgaat
ctgggtcacttaaacaagccatctatccaggcattaattcatggactaaacagacattat
tactccattactattaactatcggaaaaatgaactggaacagaagatgttgctaaatttg
cataagaagagttggatggaaggtttgacacttcaggactacagtgaacattgtaaacac
aatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggacccc
aaacgtcatttggaggaacatgtggatgtacttatgacctcaaatattgtccagtgttta
gcagctatgttggatactgtcgtatttaaataa

DBGET integrated database retrieval system