KEGG   Homo sapiens (human): 10213
Entry
10213             CDS       T01001                                 
Symbol
PSMD14, PAD1, POH1, RPN11
Name
(RefSeq) proteasome 26S subunit, non-ATPase 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    10213 (PSMD14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10213 (PSMD14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10213 (PSMD14)
   05012 Parkinson disease
    10213 (PSMD14)
   05014 Amyotrophic lateral sclerosis
    10213 (PSMD14)
   05016 Huntington disease
    10213 (PSMD14)
   05017 Spinocerebellar ataxia
    10213 (PSMD14)
   05020 Prion disease
    10213 (PSMD14)
   05022 Pathways of neurodegeneration - multiple diseases
    10213 (PSMD14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10213 (PSMD14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10213 (PSMD14)
   03051 Proteasome [BR:hsa03051]
    10213 (PSMD14)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M67
   10213 (PSMD14)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    10213 (PSMD14)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     10213 (PSMD14)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Other DBs
NCBI-GeneID: 10213
NCBI-ProteinID: NP_005796
OMIM: 607173
HGNC: 16889
Ensembl: ENSG00000115233
Pharos: O00487(Tbio)
UniProt: O00487 A0A140VKF2
Structure
Position
2:161308425..161411717
AA seq 310 aa
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacctaca
gatgctcctgcagtggacacagcagaacaagtctatatctcttccctggcactgttaaaa
atgttaaaacatggccgtgctggagttccaatggaagttatgggtttgatgcttggagaa
tttgttgatgattataccgtcagagtgattgatgtgtttgctatgccacagtcaggaaca
ggtgtcagtgtggaggcagttgatccagtgttccaagctaaaatgttggatatgttgaag
cagacaggaaggccggagatggttgttggttggtatcacagtcaccctggctttggttgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacttcgaat
ctgggtcacttaaacaagccatctatccaggcattaattcatggactaaacagacattat
tactccattactattaactatcggaaaaatgaactggaacagaagatgttgctaaatttg
cataagaagagttggatggaaggtttgacacttcaggactacagtgaacattgtaaacac
aatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggacccc
aaacgtcatttggaggaacatgtggatgtacttatgacctcaaatattgtccagtgttta
gcagctatgttggatactgtcgtatttaaataa

KEGG   Homo sapiens (human): 11047
Entry
11047             CDS       T01001                                 
Symbol
ADRM1, ARM-1, ARM1, GP110, PSMD16
Name
(RefSeq) ADRM1 26S proteasome ubiquitin receptor
  KO
K06691  26S proteasome regulatory subunit N13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    11047 (ADRM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    11047 (ADRM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11047 (ADRM1)
   05012 Parkinson disease
    11047 (ADRM1)
   05014 Amyotrophic lateral sclerosis
    11047 (ADRM1)
   05016 Huntington disease
    11047 (ADRM1)
   05017 Spinocerebellar ataxia
    11047 (ADRM1)
   05020 Prion disease
    11047 (ADRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    11047 (ADRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    11047 (ADRM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     11047 (ADRM1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD DUF1631
Other DBs
NCBI-GeneID: 11047
NCBI-ProteinID: NP_008933
OMIM: 610650
HGNC: 15759
Ensembl: ENSG00000130706
Pharos: Q16186(Tbio)
UniProt: Q16186
Structure
Position
20:62302896..62308862
AA seq 407 aa
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgacctcaggcgcgctctttccaagcctggtgccaggctctcggggcgcctccaac
aagtacttggtggagtttcgggcgggaaagatgtccctgaaggggaccaccgtgactccg
gataagcggaaagggctggtgtacattcagcagacggacgactcgcttattcacttctgc
tggaaggacaggacgtccgggaacgtggaagacgacttgatcatcttccctgacgactgt
gagttcaagcgggtgccgcagtgccccagcgggagggtctacgtgctgaagttcaaggca
gggtccaagcggcttttcttctggatgcaggaacccaagacagaccaggatgaggagcat
tgccggaaagtcaacgagtatctgaacaaccccccgatgcctggggcgctgggggccagc
ggaagcagcggccacgaactctctgcgctaggcggtgagggtggcctgcagagcctgctg
ggaaacatgagccacagccagctcatgcagctcatcggaccagccggccttggaggactg
ggtgggctgggggccctgactggacctggcctggccagcttactggggagcagtgggcct
ccagggagcagctcctcctccagctcccggagccagtcggcagcggtcaccccgtcatcc
accacctcttccacccgtgccaccccagccccttctgctccagcagctgcctcagcaact
agcccgagccccgcgcccagttccgggaatggagccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcatcctggccacgatgaacgtaccagccgggcca
gcaggcggccagcaagtggacctggccagtgtgctgacgccggagataatggctcccatc
ctcgccaacgcggatgtccaggagcgcctgcttccctacttgccatctggggagtcgctg
ccgcagaccgcggatgagatccagaataccctgacctcgccccagttccagcaggccctg
ggcatgttcagcgcagccttggcctcggggcagctgggccccctcatgtgccagttcggt
ctgcctgcagaggctgtggaggccgccaacaagggcgatgtggaagcgtttgccaaagcc
atgcagaacaacgccaagcccgagcagaaagagggcgacacgaaggacaagaaggacgaa
gaggaggacatgagcctggactga

KEGG   Homo sapiens (human): 5700
Entry
5700              CDS       T01001                                 
Symbol
PSMC1, P26S4, RPT2, S4, p56
Name
(RefSeq) proteasome 26S subunit, ATPase 1
  KO
K03062  26S proteasome regulatory subunit T2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (viruses)
nt06166  Human papillomavirus (HPV)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00365  HPV E7 to cell cycle G1/S
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5700 (PSMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5700 (PSMC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5700 (PSMC1)
   05165 Human papillomavirus infection
    5700 (PSMC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5700 (PSMC1)
   05012 Parkinson disease
    5700 (PSMC1)
   05014 Amyotrophic lateral sclerosis
    5700 (PSMC1)
   05016 Huntington disease
    5700 (PSMC1)
   05017 Spinocerebellar ataxia
    5700 (PSMC1)
   05020 Prion disease
    5700 (PSMC1)
   05022 Pathways of neurodegeneration - multiple diseases
    5700 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5700 (PSMC1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5700 (PSMC1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 AAA_25 AAA_33 ATPase IstB_IS21 AAA_28 AAA_3 RNA_helicase AAA_14 Mg_chelatase TIP49 AAA_7 Prot_ATP_OB_N NACHT PhoH AAA_24 AAA_30 NB-ARC ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 5700
NCBI-ProteinID: NP_002793
OMIM: 602706
HGNC: 9547
Ensembl: ENSG00000100764
Pharos: P62191(Tbio)
UniProt: P62191 Q53XL8
Structure
Position
14:90256553..90275429
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtgacacctcacactcagtgccggtta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgagggggaccccgatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctttcatttgtagac
aaggatctgctggaacctggctgctcggtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacggatcccctggtcacagtgatgaaggtagaaaaggccccc
caggagacctatgcagatattggggggttggacaaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccatcctgaatattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttgttagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaattgttccgagttgctgaagaacatgcaccgtcc
atcgtgtttattgatgaaattgacgccattgggacaaaaagatatgactccaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgctgaaccagttggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaagattgagttccccctgcctgatgaaaagacg
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacctgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaggggctgtatctc
taa

KEGG   Homo sapiens (human): 5701
Entry
5701              CDS       T01001                                 
Symbol
PSMC2, MSS1, Nbla10058, RPT1, S7
Name
(RefSeq) proteasome 26S subunit, ATPase 2
  KO
K03061  26S proteasome regulatory subunit T1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5701 (PSMC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5701 (PSMC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5701 (PSMC2)
   05012 Parkinson disease
    5701 (PSMC2)
   05014 Amyotrophic lateral sclerosis
    5701 (PSMC2)
   05016 Huntington disease
    5701 (PSMC2)
   05017 Spinocerebellar ataxia
    5701 (PSMC2)
   05020 Prion disease
    5701 (PSMC2)
   05022 Pathways of neurodegeneration - multiple diseases
    5701 (PSMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5701 (PSMC2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5701 (PSMC2)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 DUF815 AAA_2 RuvB_N AAA_33 AAA_7 AAA_28 AAA_18 Sigma54_activ_2 Mg_chelatase AAA_14 TIP49 AAA_24 RNA_helicase HMW1C_N T2SSE IstB_IS21
Other DBs
NCBI-GeneID: 5701
NCBI-ProteinID: NP_002794
OMIM: 154365
HGNC: 9548
Ensembl: ENSG00000161057
Pharos: P35998(Tbio)
UniProt: P35998 A0A140VK70
Structure
Position
7:103347524..103369395
AA seq 433 aa
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccggattacctcggtgccgatcagcggaagaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgagggggatattgccttgttgaaaacttatggtcagagcact
tactctaggcagatcaagcaagttgaagatgacattcagcaacttctcaagaaaattaat
gagctcactggtattaaagaatctgacactggcctggccccaccagcactctgggatttg
gctgcagataagcagacactccagagtgaacagcctttacaggttgccaggtgtacaaag
ataatcaatgctgattcggaggacccaaaatacattatcaacgtaaagcagtttgccaag
tttgtggtggaccttagtgatcaggtggcacctactgacattgaagaagggatgagagtg
ggcgtggatagaaataaatatcaaattcacattccattgcctcctaagattgacccaaca
gttaccatgatgcaggtggaagagaaacctgatgtcacatacagtgatgttggtggctgt
aaggaacagattgagaaactgcgagaagtagttgaaaccccattacttcatccagagagg
tttgtgaaccttggcattgagcctcccaagggcgtgctgctctttggtccacccggtaca
ggcaagacactctgtgcgcgggcagttgctaatcggactgatgcgtgcttcattcgagtt
attggatctgagcttgtacagaaatacgtcggtgagggggctcgaatggttcgtgaactc
tttgaaatggccagaacaaaaaaagcctgccttatcttctttgatgaaattgatgctatt
ggaggggctcgttttgatgatggtgctggaggtgacaatgaagtgcagagaacaatgttg
gaactgatcaatcagcttgatggttttgatcctagaggcaatattaaagtgctgatggcc
actaacagacctgatactttggatccagcactgatgaggccagggagattggatagaaaa
attgaatttagcttgcccgatctagagggtcggacccacatatttaagattcacgctcgt
tcaatgagtgttgaaagagatatcagatttgaactgttagcacgactgtgtccaaatagc
actggtgctgagattagaagcgtctgcacagaggctggtatgtttgccatcagagcacgg
cgaaaaattgctaccgagaaggatttcttggaagctgtaaataaggtcattaagtcttat
gccaaattcagtgctactcctcgttacatgacatacaactga

KEGG   Homo sapiens (human): 5702
Entry
5702              CDS       T01001                                 
Symbol
PSMC3, DCIDP, RPT5, TBP1
Name
(RefSeq) proteasome 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5702 (PSMC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5702 (PSMC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5702 (PSMC3)
   05012 Parkinson disease
    5702 (PSMC3)
   05014 Amyotrophic lateral sclerosis
    5702 (PSMC3)
   05016 Huntington disease
    5702 (PSMC3)
   05017 Spinocerebellar ataxia
    5702 (PSMC3)
   05020 Prion disease
    5702 (PSMC3)
   05022 Pathways of neurodegeneration - multiple diseases
    5702 (PSMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5702 (PSMC3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5702 (PSMC3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 Mg_chelatase AAA_11 DUF815 PhoH Sigma54_activat DUF5827 IstB_IS21 AAA_24 ATPase AAA_7 DUF3713 RNA_helicase
Other DBs
NCBI-GeneID: 5702
NCBI-ProteinID: NP_002795
OMIM: 186852
HGNC: 9549
Ensembl: ENSG00000165916
Pharos: P17980(Tbio)
UniProt: P17980 A0A140VK42
Structure
Position
11:complement(47418775..47426439)
AA seq 439 aa
MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaatctgctgccgaatattgagagtccagtgactcggcaggagaagatggcgaccgtg
tgggatgaggccgagcaagatggaattggggaggaggtgctcaagatgtccacggaggag
atcatccagcgcacacggctgctggacagtgagatcaagatcatgaagagtgaagtgttg
agagtcacccatgagctccaagccatgaaggacaagataaaagagaacagtgagaaaatc
aaagtgaacaagaccctgccgtaccttgtctccaacgtcatcgagctcctggatgttgat
cctaatgaccaagaggaggatggtgccaatattgacctggactcccagaggaagggcaag
tgtgctgtgatcaaaacctctacacgacagacgtacttccttcctgtgattgggttggtg
gatgctgaaaagctaaagccaggagacctggtgggtgtgaacaaagactcctatctgatc
ctggagacgctgcccacagagtatgactcgcgggtgaaggccatggaggtagacgagagg
cccacggagcaatacagtgacattgggggtttggacaagcagatccaggagctggtggag
gccattgtcttgccaatgaaccacaaggagaagtttgagaacttggggatccaacctcca
aaaggggtgctgatgtatgggcccccagggacggggaagaccctcctggcccgggcctgt
gccgcacagactaaggccaccttcctaaagctggctggcccccagctggtgcagatgttc
attggagatggtgccaagctagtccgggatgcctttgccctggccaaggagaaagcgccc
tctatcatcttcattgatgagttggatgccatcggcaccaagcgctttgacagtgagaag
gctggggaccgggaggtgcagaggacaatgctggagcttctgaaccagctggatggcttc
cagcccaacacccaagttaaggtaattgcagccacaaacagggtggacatcctggacccc
gccctcctccgctcgggccgccttgaccgcaagatagagttcccgatgcccaatgaggag
gcccgggccagaatcatgcagatccactcccgaaagatgaatgtcagtcctgacgtgaac
tacgaggagctggcccgctgcacagatgacttcaatggggcccagtgcaaggctgtgtgt
gtggaggcgggcatgatcgcactgcgcaggggtgccacggagctcacccacgaggactac
atggaaggcatcctggaggtgcaggccaagaagaaagccaacctacaatactacgcctag

KEGG   Homo sapiens (human): 5704
Entry
5704              CDS       T01001                                 
Symbol
PSMC4, MIP224, RPT3, S6, TBP-7, TBP7
Name
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5704 (PSMC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5704 (PSMC4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5704 (PSMC4)
   05012 Parkinson disease
    5704 (PSMC4)
   05014 Amyotrophic lateral sclerosis
    5704 (PSMC4)
   05016 Huntington disease
    5704 (PSMC4)
   05017 Spinocerebellar ataxia
    5704 (PSMC4)
   05020 Prion disease
    5704 (PSMC4)
   05022 Pathways of neurodegeneration - multiple diseases
    5704 (PSMC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5704 (PSMC4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5704 (PSMC4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase AAA_28 NTPase_1 AAA_18 AAA_33 Sigma54_activat NACHT TIP49 AAA_3 CENP-F_leu_zip IstB_IS21 AAA_7 TsaE ATPase_2 Zeta_toxin AAA_24 AAA_25 AAA_17 NB-ARC Parvo_NS1 DUF3450 ABC_tran AAA_30
Other DBs
NCBI-GeneID: 5704
NCBI-ProteinID: NP_006494
OMIM: 602707
HGNC: 9551
Ensembl: ENSG00000013275
Pharos: P43686(Tbio)
UniProt: P43686 A8K2M0
Structure
Position
19:39971165..39981764
AA seq 418 aa
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcatcttggtggagaaggctcaggatgagatcccagcactgtccgtg
tcccggccccagaccggcctgtccttcctgggccctgagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagctggagttcctggaggtgcaggaggaatac
atcaaagatgagcaaaagaacctgaaaaaggaatttctccatgcccaggaggaggtgaag
cgaatccaaagcatcccgctggtcatcggacaatttctggaggctgtggatcagaataca
gccatcgtgggctctaccacaggctccaactattatgtgcgcatcctgagcaccatcgat
cgggagctgctcaagcccaacgcctcagtggccctccacaagcacagcaatgcactggtg
gacgtgctgccccccgaagccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtacgcggacatcggaggcatggacatccagaagcaggaggtgcgggaggcc
gtggagctcccgctcacgcatttcgagctctacaagcagatcggcatcgatcccccccga
ggcgtcctcatgtatggcccacctggctgtgggaagaccatgttggcaaaggcggtggca
catcacacaacagctgcattcatccgggtcgtgggctcggagtttgtacagaagtatctg
ggtgagggcccccgcatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagacgagattgatgccatcgccaccaagagattcgatgctcagacaggg
gccgacagggaggttcagaggatcctgctggagctgctgaatcagatggatggatttgat
cagaatgtcaatgtcaaggtaatcatggccacaaacagagcagacaccctggatccggcc
ctgctacggccaggacggctggaccgtaaaattgaatttccacttcctgaccgccgccag
aagagattgattttctccactatcactagcaagatgaacctctctgaggaggttgacttg
gaagactatgtggcccggccagataagatttcaggagctgatattaactccatctgtcag
gagagtggaatgttggctgtccgtgaaaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagactgtcatcaagaaggacgagcaggagcatgagttttacaagtga

KEGG   Homo sapiens (human): 5705
Entry
5705              CDS       T01001                                 
Symbol
PSMC5, RPT6, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
Name
(RefSeq) proteasome 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5705 (PSMC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5705 (PSMC5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5705 (PSMC5)
   05012 Parkinson disease
    5705 (PSMC5)
   05014 Amyotrophic lateral sclerosis
    5705 (PSMC5)
   05016 Huntington disease
    5705 (PSMC5)
   05017 Spinocerebellar ataxia
    5705 (PSMC5)
   05020 Prion disease
    5705 (PSMC5)
   05022 Pathways of neurodegeneration - multiple diseases
    5705 (PSMC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5705 (PSMC5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5705 (PSMC5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 AAA_18 AAA_3 Mg_chelatase ATPase FapA PhoH IstB_IS21 AAA_28 AAA_24 AAA_14 Sigma54_activat AAA_7 AAA_17 DUF815 bpMoxR AAA_25 Parvo_NS1 Zeta_toxin RNA_helicase HR1 TsaE AAA_19 AAA_11
Other DBs
NCBI-GeneID: 5705
NCBI-ProteinID: NP_002796
OMIM: 601681
HGNC: 9552
Ensembl: ENSG00000087191
Pharos: P62195(Tbio)
UniProt: P62195 A0A140VJS3
Structure
Position
17:63827431..63832019
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgacggaccagagcagatggagctggaggaggggaaggcaggcagcggactc
cgccaatattatctgtccaagattgaagaactccagctgattgtgaatgataagagccaa
aacctccggaggctgcaggcacagaggaacgaactaaatgctaaagttcgcctattgcgg
gaggagctacagctgctgcaggagcagggctcctatgtgggggaagtagtccgggccatg
gataagaagaaagtgttggtcaaggtacatcctgaaggtaaatttgttgtagacgtggac
aaaaacattgacatcaatgatgtgacacccaattgccgggtggctctaaggaatgacagc
tacactctgcacaagatcctgcccaacaaggtagacccattagtgtcactgatgatggtg
gagaaagtaccagattcaacttatgagatgattggtggactggacaaacagatcaaggag
atcaaagaagtgatcgagctgcctgttaagcatcctgagctcttcgaagcactgggcatt
gctcagcccaagggagtgctgctgtatggacctccaggcactgggaagacactgttggcc
cgggctgtggctcatcatacggactgtacctttattcgtgtctctggctctgaactggta
cagaaattcataggggaaggggcaagaatggtgagggagctgtttgtcatggcacgggaa
catgctccatctatcatcttcatggacgaaatcgactccatcggctcctcgcggctggag
gggggttctggaggggacagtgaagtgcagcgcacgatgctggagttgctcaaccagctc
gacggctttgaggccaccaagaacatcaaggttatcatggctactaataggattgatatc
ctggactcggcactgcttcgcccagggcgcattgacagaaaaattgaattcccacccccc
aatgaggaggcccggctggacattttgaagattcattctcggaagatgaacctgacccgg
gggatcaacctgagaaaaattgctgagctcatgccaggagcatcaggggctgaagtgaag
ggcgtgtgcacagaagctggcatgtatgccctgcgagaacggcgagtccatgtcactcag
gaggactttgagatggcagtagccaaggtcatgcagaaggacagtgagaaaaacatgtcc
atcaagaaattatggaagtga

KEGG   Homo sapiens (human): 5706
Entry
5706              CDS       T01001                                 
Symbol
PSMC6, RPT5, SUG2, p42
Name
(RefSeq) proteasome 26S subunit, ATPase 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5706 (PSMC6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5706 (PSMC6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5706 (PSMC6)
   05012 Parkinson disease
    5706 (PSMC6)
   05014 Amyotrophic lateral sclerosis
    5706 (PSMC6)
   05016 Huntington disease
    5706 (PSMC6)
   05017 Spinocerebellar ataxia
    5706 (PSMC6)
   05020 Prion disease
    5706 (PSMC6)
   05022 Pathways of neurodegeneration - multiple diseases
    5706 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5706 (PSMC6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5706 (PSMC6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_2 AAA_22 RuvB_N AAA_33 AAA_18 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 DUF5906 AAA_3 RNA_helicase TIP49 bpMoxR Mg_chelatase TPR_MLP1_2 AAA_11 TsaE Wtap AAA_24 ATPase AAA_25 NACHT AAA_19 AAA_28 IstB_IS21 Med4
Other DBs
NCBI-GeneID: 5706
NCBI-ProteinID: NP_002797
OMIM: 602708
HGNC: 9553
Ensembl: ENSG00000100519
Pharos: P62333(Tbio)
UniProt: P62333 A0A087X2I1
Structure
Position
14:52707200..52728590
AA seq 389 aa
MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggaccctagagataaggcgcttcaggactaccgcaagaagttgcttgaacacaag
gagatcgacggccgtcttaaggagttaagggaacaattaaaagaacttaccaagcagtat
gaaaagtctgaaaatgatctgaaggccctacagagtgttgggcagatcgtgggtgaagtg
cttaaacagttaactgaagaaaaattcattgttaaagctaccaatggaccaagatatgtt
gtgggttgtcgtcgacagcttgacaaaagtaagctgaagccaggaacaagagttgctttg
gatatgactacactaactatcatgagatatttgccgagagaggtggatccactggtttat
aacatgtctcatgaggaccctgggaatgtttcttattctgagattggagggctatcagaa
cagatccgggaattaagagaggtgatagaattacctcttacaaacccagagttatttcag
cgtgtaggaataatacctccaaaaggctgtttgttatatggaccaccaggtacgggaaaa
acactcttggcacgagccgttgctagccagctggactgcaatttcttaaaggttgtatct
agttctattgtagacaagtacattggtgaaagtgctcgtttgatcagagaaatgtttaat
tatgctagagatcatcaaccatgcatcatttttatggatgaaatagatgctattggtggt
cgtcggttttctgagggtacttcagctgacagagagattcagagaacgttaatggagtta
ctgaatcaaatggatggatttgatactctgcatagagttaaaatgatcatggctacaaac
agaccagatacactggatcctgctttgctgcgtccaggaagattagatagaaaaatacat
attgatttgccaaatgaacaagcaagattagacatactgaaaatccatgcaggtcccatt
acaaagcatggtgaaatagattatgaagcaattgtgaagctttcggatggctttaatgga
gcagatctgagaaatgtttgtactgaagcaggtatgttcgcaattcgtgctgatcatgat
tttgtagtacaggaagacttcatgaaagcagtcagaaaagtggctgattctaagaagctg
gagtctaaattggactacaaacctgtgtaa

KEGG   Homo sapiens (human): 5707
Entry
5707              CDS       T01001                                 
Symbol
PSMD1, P112, Rpn2, S1
Name
(RefSeq) proteasome 26S subunit, non-ATPase 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5707 (PSMD1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5707 (PSMD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5707 (PSMD1)
   05012 Parkinson disease
    5707 (PSMD1)
   05014 Amyotrophic lateral sclerosis
    5707 (PSMD1)
   05016 Huntington disease
    5707 (PSMD1)
   05017 Spinocerebellar ataxia
    5707 (PSMD1)
   05020 Prion disease
    5707 (PSMD1)
   05022 Pathways of neurodegeneration - multiple diseases
    5707 (PSMD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5707 (PSMD1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5707 (PSMD1)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 Tim54
Other DBs
NCBI-GeneID: 5707
NCBI-ProteinID: NP_002798
OMIM: 617842
HGNC: 9554
Ensembl: ENSG00000173692
Pharos: Q99460(Tbio)
UniProt: Q99460
Structure
Position
2:231056867..231172827
AA seq 953 aa
MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
EKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRY
QPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgatcacctcggccgctggaattatttctcttctggatgaagatgaaccacagcttaag
gaatttgcactacacaaattgaatgcagttgttaatgacttctgggcagaaatttccgag
tccgtagacaaaatagaggttttatacgaagatgaaggtttccggagtcggcagtttgca
gccttagtggcatctaaagtattttatcacctgggggcttttgaggagtctctgaattat
gctcttggagcaggggacctcttcaatgtcaatgataactctgaatatgtggaaactatt
atagcaaaatgcattgatcactacaccaaacaatgtgtggaaaatgcagatttgcctgaa
ggagaaaaaaaaccaattgaccagagattggaaggcatcgtaaataaaatgttccagcga
tgtctagatgatcacaagtataaacaggctattggcattgctctggagacacgaagactg
gacgtctttgaaaagaccatactggagtcgaatgatgtcccaggaatgttagcttatagc
cttaagctctgcatgtctttaatgcagaataaacagtttcggaataaagtactaagagtt
ctagttaaaatctacatgaacttggagaaacctgatttcatcaatgtttgtcagtgctta
attttcttagatgatcctcaggctgtgagtgatatcttagagaaactggtaaaggaagac
aacctcctgatggcatatcagatttgttttgatttgtatgaaagtgctagccagcagttt
ttgtcatctgtaatccagaatcttcgaactgttggcacccctattgcttctgtgcctgga
tccactaatacgggtactgttccgggatcagagaaagacagtgactcgatggaaacagaa
gaaaagacaagcagtgcatttgtaggaaagacaccagaagccagtccagagcctaaggac
cagactttgaaaatgattaaaattttaagtggtgaaatggctattgagttacatctgcag
ttcttaatacgaaacaataatacagacctcatgattctaaaaaacacaaaggatgcagta
cggaattctgtatgtcatactgcaaccgttatagcaaactcttttatgcactgtgggaca
accagtgaccagtttcttagagataatttggaatggttagccagagccactaactgggca
aaatttactgctacagccagtttgggtgtaattcataagggtcatgaaaaagaagcatta
cagttaatggcaacataccttcccaaggatacttctccaggatcagcctatcaggaaggt
ggaggtctctatgcactaggtcttattcatgccaatcatggtggtgatataattgactat
ctgcttaatcagcttaagaacgccagcaatgatatcgttagacacggtggcagtctgggc
cttggtttggcagccatgggaactgcacgtcaagatgtttatgatttgctaaaaacaaac
ctttatcaggatgatgcagtaacaggggaagcagctggcctggccctaggtttggttatg
ttgggctctaaaaatgctcaggctattgaggacatggttggttatgcacaagaaactcaa
catgagaagattctgcgtggtcttgcagttggcatagctttagtaatgtatgggaggatg
gaagaggctgatgctctcattgaatctctctgtcgtgacaaggacccaattcttcgaagg
tctggaatgtatactgtagccatggcttattgtggctctggtaacaacaaagcaattcga
cgcctgctacatgttgctgtaagtgatgttaatgatgatgtcaggagggcagcagtagaa
tcacttgggttcattctattcagaacccctgaacagtgcccaagtgttgtctctttgttg
tcagagagttacaaccctcatgtgcgctacggagctgcaatggccttggggatatgctgt
gctggtacaggaaacaaggaagccattaatttgctagaaccaatgacaaacgaccccgtg
aactacgtgaggcaaggggcactcatagcttcagctctcatcatgatccagcagactgaa
atcacttgtccaaaggtgaatcagttcagacagctgtattccaaagtcatcaatgataag
catgatgatgtcatggccaagtttggcgctattctggcccagggcatactggatgcaggt
ggtcataatgtcacaatctccttgcagtccaggactgggcatactcatatgccttctgtg
gttggcgtccttgtatttacccagttttggttctggtttcctctttcacacttcctgtca
ttggcttatacccctacctgtgtcattggccttaacaaggacttaaagatgccgaaagtt
cagtataaatcgaactgtaaaccatccacatttgcatatcctgcccctctggaagtacca
aaagaaaaagaaaaggaaaaggtttctactgctgtattatctataactgccaaggctaaa
aagaaggaaaaagaaaaggaaaaaaaggaggaggagaaaatggaagtggatgaggcagag
aaaaaggaggaaaaagagaagaaaaaagaacctgagccaaacttccagttattggataac
ccagcccgagttatgcctgcccagcttaaggtcctaaccatgccggagacctgtagatac
cagcctttcaaaccactctctattggaggcatcatcattctgaaggataccagtgaagac
attgaggagctggtggaacctgtggcagcacatggcccaaaaatcgaggaggaggaacaa
gagccagaacccccagaaccatttgagtatattgatgattaa

KEGG   Homo sapiens (human): 5708
Entry
5708              CDS       T01001                                 
Symbol
PSMD2, P97, RPN1, S2, TRAP2
Name
(RefSeq) proteasome 26S subunit ubiquitin receptor, non-ATPase 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5708 (PSMD2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5708 (PSMD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5708 (PSMD2)
   05012 Parkinson disease
    5708 (PSMD2)
   05014 Amyotrophic lateral sclerosis
    5708 (PSMD2)
   05016 Huntington disease
    5708 (PSMD2)
   05017 Spinocerebellar ataxia
    5708 (PSMD2)
   05020 Prion disease
    5708 (PSMD2)
   05022 Pathways of neurodegeneration - multiple diseases
    5708 (PSMD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5708 (PSMD2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5708 (PSMD2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep THAP
Other DBs
NCBI-GeneID: 5708
NCBI-ProteinID: NP_002799
OMIM: 606223
HGNC: 9559
Ensembl: ENSG00000175166
Pharos: Q13200(Tbio)
UniProt: Q13200
Structure
Position
3:184299241..184309050
AA seq 908 aa
MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggaggccgggacaaggcgccggtgcagccccagcagtctccagcggcggcc
cccggcggcacggacgagaagccgagcggcaaggagcggcgggatgccggggacaaggac
aaagaacaggagctgtctgaagaggataaacagcttcaagatgaactggagatgctcgtg
gaacgactaggggagaaggatacatccctgtatcgaccagcgctggaggaattgcgaagg
cagattcgttcttctacaacttccatgacttcagtgcccaagcctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatggcccctggggagaataagcgt
tttgctgctgacatcatctccgttttggccatgaccatgagtggggagcgtgagtgcctc
aagtatcggctagtgggctcccaggaggaattggcatcatggggtcatgagtatgtcagg
catctggcaggagaagtggctaaggagtggcaggagctggatgacgcagagaaggtccag
cgggagcctctgctcactctggtgaaggaaatcgtcccctataacatggcccacaatgca
gagcatgaggcttgcgacctgcttatggaaattgagcaggtggacatgctggagaaggac
attgatgaaaatgcatatgcaaaggtctgcctttatctcaccagttgtgtgaattacgtg
cctgagcctgagaactcagccctactgcgttgtgccctgggtgtgttccgaaagtttagc
cgcttccctgaagctctgagattggcattgatgctcaatgacatggagttggtagaagac
atcttcacctcctgcaaggatgtggtagtacagaaacagatggcattcatgctaggccgg
catggggtgttcctggagctgagtgaagatgtcgaggagtatgaggacctgacagagatc
atgtccaatgtacagctcaacagcaacttcttggccttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaacaacaggtttgggggc
agtggctctcaggtggactctgcccgcatgaacctggcctcctcttttgtgaatggcttt
gtgaatgcagcttttggccaagacaagctgctaacagatgatggcaacaaatggctttac
aagaacaaggaccacggaatgttgagtgcagctgcatctcttgggatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtacctgtactcctctgaggactacatt
aagtcaggagctcttcttgcctgtggcatagtgaactctggggtccggaatgagtgtgac
cctgctctggcactgctctcagactatgttctccacaacagcaacaccatgagacttggt
tccatctttgggctaggcttggcttatgctggctcaaatcgtgaagatgtcctaacactg
ctgctgcctgtgatgggagattcaaagtccagcatggaggtggcaggtgtcacagcttta
gcctgtggaatgatagcagtagggtcctgcaatggagatgtaacttccactatccttcag
accatcatggagaagtcagagactgagctcaaggatacttatgctcgttggcttcctctt
ggactgggtctcaaccacctggggaagggtgaggccatcgaggcaatcctggctgcactg
gaggttgtgtcagagccattccgcagttttgccaacacactggtggatgtgtgtgcatat
gcaggctctgggaatgtgctgaaggtgcagcagctgctccacatttgtagcgaacacttt
gactccaaagagaaggaggaagacaaagacaagaaggaaaagaaagacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtggctgttctggggattgcccttatt
gctatgggggaggagattggtgcagagatggcattacgaacctttggccacttgctgaga
tatggggagcctacactccggagggctgtacctttagcactggccctcatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatttttgccatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgctgcgccagttagctcaatatcatgccaaggacccaaacaacctcttc
atggtgcgcttggcacagggcctgacacatttagggaagggcacccttaccctctgcccc
taccacagcgaccggcagcttatgagccaggtggccgtggctggactgctcactgtgctt
gtctctttcctggatgttcgaaacattattctaggcaaatcacactatgtattgtatggg
ctggtggctgccatgcagccccgaatgctggttacgtttgatgaggagctgcggccattg
ccagtgtctgtccgtgtgggccaggcagtggatgtggtgggccaggctggcaagccgaag
actatcacagggttccagacgcatacaaccccagtgttgttggcccacggggaacgggca
gaattggccactgaggagtttcttcctgttacccccattctggaaggttttgttatcctt
cggaagaaccccaattatgatctctaa

DBGET integrated database retrieval system