KEGG   Homo sapiens (human): 10215
Entry
10215             CDS       T01001                                 

Gene name
OLIG2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19
Definition
(RefSeq) oligodendrocyte transcription factor 2
  KO
K09085  class B basic helix-loop-helix protein 1/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10215 (OLIG2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    10215 (OLIG2)
SSDB
Motif
Pfam: HLH SR-25 UBN_AB
Other DBs
NCBI-GeneID: 10215
NCBI-ProteinID: NP_005797
OMIM: 606386
HGNC: 9398
Ensembl: ENSG00000205927
Vega: OTTHUMG00000065032
Pharos: Q13516(Tbio)
UniProt: Q13516
Position
21q22.11
AA seq 323 aa
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggactcggacgccagcctggtgtccagccgcccgtcgtcgccagagcccgatgacctt
tttctgccggcccggagtaagggcagcagcggcagcgccttcactgggggcaccgtgtcc
tcgtccaccccgagtgactgcccgccggagctgagcgccgagctgcgcggcgctatgggc
tctgcgggcgcgcatcctggggacaagctaggaggcagtggcttcaagtcatcctcgtcc
agcacctcgtcgtctacgtcgtcggcggctgcgtcgtccaccaagaaggacaagaagcaa
atgacagagccggagctgcagcagctgcgtctcaagatcaacagccgcgagcgcaagcgc
atgcacgacctcaacatcgccatggatggcctccgcgaggtcatgccgtacgcacacggc
ccttcggtgcgcaagctttccaagatcgccacgctgctgctggcgcgcaactacatcctc
atgctcaccaactcgctggaggagatgaagcgactggtgagcgagatctacgggggccac
cacgctggcttccacccgtcggcctgcggcggcctggcgcactccgcgcccctgcccgcc
gccaccgcgcacccggcagcagcagcgcacgccgcacatcaccccgcggtgcaccacccc
atcctgccgcccgccgccgcagcggctgctgccgccgctgcagccgcggctgtgtccagc
gcctctctgcccggatccgggctgccgtcggtcggctccatccgtccaccgcacggccta
ctcaagtctccgtctgctgccgcggccgccccgctggggggcgggggcggcggcagtggg
gcgagcgggggcttccagcactggggcggcatgccctgcccctgcagcatgtgccaggtg
ccgccgccgcaccaccacgtgtcggctatgggcgccggcagcctgccgcgcctcacctcc
gacgccaagtga

DBGET integrated database retrieval system