KEGG   Homo sapiens (human): 102157402Help
Entry
102157402         CDS       T01001                                 

Gene name
AK6, AD-004, CGI-137, CINAP, CIP, hCINAP
Definition
(RefSeq) adenylate kinase 6
  KO
K18532  adenylate kinase [EC:2.7.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa03008  Ribosome biogenesis in eukaryotes
Module
hsa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102157402 (AK6)
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102157402 (AK6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    102157402 (AK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     102157402 (AK6)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    102157402 (AK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_18 AAA_17 SKI AAA AAA_28 AAA_33 ADK dNK AAA_5 AAA_16 AAA_22 NTPase_1 RNA_helicase Cytidylate_kin KTI12 AAA_24 AAA_14 ATPase RuvB_N AAA_3 TsaE NACHT Rad17 Cytidylate_kin2 PduV-EutP IstB_IS21 Mg_chelatase AAA_25
Motif
Other DBs
NCBI-GeneID: 102157402
NCBI-ProteinID: NP_057367
HGNC: 49151
Ensembl: ENSG00000085231
Vega: OTTHUMG00000187252
Pharos: Q9Y3D8(Tbio)
UniProt: Q9Y3D8
Structure
PDB: 

Position
5q13.2
AA seq 172 aa AA seqDB search
MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDR
VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNI
QCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttccgaacatcctgctcaccggtacaccaggggttggaaaaaccacactaggc
aaagaacttgcgtcaaaatcaggactgaaatacattaatgtgggtgatttagctcgagaa
gagcaattgtatgatggctatgatgaagagtatgactgtcccattttagatgaagacaga
gtagttgatgagttagataaccaaatgagagaaggtggagttattgttgattaccatggt
tgtgatttcttccctgaacgctggtttcatatagtttttgtgctgagaacagataccaat
gtattgtacgaaagacttgaaacaaggggttataatgagaagaaactaacagacaatatt
cagtgtgagatttttcaagttctttatgaagaagccacagcatcctacaaggaagaaatc
gtgcatcagctgcccagtaataaaccagaagagctagaaaataatgtagatcagatcttg
aaatggattgagcagtggatcaaagatcataactcttga

DBGET integrated database retrieval system