KEGG   Homo sapiens (human): 10217Help
Entry
10217             CDS       T01001                                 

Gene name
CTDSPL, C3orf8, HYA22, PSR1, RBSP3, SCP3
Definition
(RefSeq) CTD small phosphatase like
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10217 (CTDSPL)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10217 (CTDSPL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     10217 (CTDSPL)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   10217 (CTDSPL)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     10217 (CTDSPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-GeneID: 10217
NCBI-ProteinID: NP_001008393
OMIM: 608592
HGNC: 16890
Ensembl: ENSG00000144677
Vega: OTTHUMG00000155942
Pharos: O15194(Tbio)
UniProt: O15194
Structure
PDB: 

Position
3p22.2
AA seq 276 aa AA seqDB search
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPP
SSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS
SFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVAD
LLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQS
WFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggacggcccggccatcatcacccaggtgaccaaccccaaggaggacgagggccggttg
ccgggcgcgggcgagaaagcctcccagtgcaacgtcagcttaaagaagcagaggagccgc
agcatccttagctccttcttctgctgcttccgtgattacaatgtggaggcccctccaccc
agcagccccagtgtgcttccgccactggtggaggagaatggtgggcttcagaagggtgac
cagaggcaggtcattcccataccaagtccaccagctaagtaccttcttccagaggtgacg
gtgcttgactatggaaagaaatgtgtggtcattgatttagatgaaacattggtgcacagt
tcgtttaagcctattagtaatgctgattttattgttccggttgaaatcgatggaactata
catcaggtgtatgtgctgaagcggccacatgtggacgagttcctccagaggatggggcag
ctttttgaatgtgtgctctttactgccagcttggccaagtatgcagaccctgtggctgac
ctcctagaccgctggggtgtgttccgggcccggctcttcagagaatcatgtgtttttcat
cgtgggaactacgtgaaggacctgagtcgccttgggcgggagctgagcaaagtgatcatt
gttgacaattcccctgcctcatacatcttccatcctgagaatgcagtgcctgtgcagtcc
tggttcgatgacatgacggacacggagctgctggacctcatccccttctttgagggcctg
agccgggaggacgacgtgtacagcatgctgcacagactctgcaataggtag

DBGET integrated database retrieval system