KEGG   Homo sapiens (human): 1022Help
Entry
1022              CDS       T01001                                 

Gene name
CDK7, CAK, CAK1, CDKN7, HCAK, MO15, STK1, p39MO15
Definition
(RefSeq) cyclin dependent kinase 7
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa04110  Cell cycle
Drug target
Alvocidib (DG02041): D02880 D09868
Zotiraciclib (DG03058): D11599 D11600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    1022 (CDK7)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1022 (CDK7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1022 (CDK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1022 (CDK7)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    1022 (CDK7)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1022 (CDK7)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1022 (CDK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1022 (CDK7)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1022 (CDK7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1022 (CDK7)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     1022 (CDK7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     1022 (CDK7)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     1022 (CDK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH RIO1 Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 1022
NCBI-ProteinID: NP_001790
OMIM: 601955
HGNC: 1778
Ensembl: ENSG00000134058
Vega: OTTHUMG00000099358
Pharos: P50613(Tchem)
UniProt: P50613 A0A0S2Z3F9
Structure
PDB: 

Position
5q13.2
AA seq 346 aa AA seqDB search
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacgtgaagtctcgggcaaagcgttatgagaagctggacttccttggggag
ggacagtttgccaccgtttacaaggccagagataagaacaccaaccaaattgtcgccatt
aagaaaatcaaacttggacatagatcagaagctaaagatggtataaatagaaccgcctta
agagagataaaattattacaggagctaagtcatccaaatataattggtctccttgatgct
tttggacataaatctaatattagccttgtctttgattttatggaaactgatctagaggtt
ataataaaggataatagtcttgtgctgacaccatcacacatcaaagcctacatgttgatg
actcttcaaggattagaatatttacatcaacattggatcctacatagggatctgaaacca
aacaacttgttgctagatgaaaatggagttctaaaactggcagattttggcctggccaaa
tcttttgggagccccaatagagcttatacacatcaggttgtaaccaggtggtatcgggcc
cccgagttactatttggagctaggatgtatggtgtaggtgtggacatgtgggctgttggc
tgtatattagcagagttacttctaagggttccttttttgccaggagattcagaccttgat
cagctaacaagaatatttgaaactttgggcacaccaactgaggaacagtggccggacatg
tgtagtcttccagattatgtgacatttaagagtttccctggaatacctttgcatcacatc
ttcagtgcagcaggagacgacttactagatctcatacaaggcttattcttatttaatcca
tgtgctcgaattacggccacacaggcactgaaaatgaagtatttcagtaatcggccaggg
ccaacacctggatgtcagctgccaagaccaaactgtccagtggaaaccttaaaggagcaa
tcaaatccagctttggcaataaaaaggaaaagaacagaggccttagaacaaggaggattg
cccaagaaactaattttttaa

DBGET integrated database retrieval system