KEGG   Homo sapiens (human): 10226
Entry
10226             CDS       T01001                                 

Symbol
PLIN3, M6PRBP1, PP17, TIP47
Name
(RefSeq) perilipin 3
  KO
K20287  perilipin-3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10226 (PLIN3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    10226 (PLIN3)
SSDB
Motif
Pfam: Perilipin SF-assemblin SOAR ING
Other DBs
NCBI-GeneID: 10226
NCBI-ProteinID: NP_005808
OMIM: 602702
HGNC: 16893
Ensembl: ENSG00000105355
Vega: OTTHUMG00000180249
Pharos: O60664(Tbio)
UniProt: O60664
Position
19p13.3
AA seq 434 aa
MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVC
DAAEKGVRTLTAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLAD
TKELVSSKVSGAQEMVSSAKDTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSR
LGQMVLSGVDTVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQSYFVRLG
SLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQVLSLMETVKQGVDQKLVEGQEKLHQM
WLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQ
QARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP
FAPGITEKAPEEKK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtctgccgacggggcagaggctgatggcagcacccaggtgacagtggaagaaccggta
cagcagcccagtgtggtggaccgtgtggccagcatgcctctgatcagctccacctgcgac
atggtgtccgcagcctatgcctccaccaaggagagctacccgcacatcaagactgtctgc
gacgcagcagagaagggagtgaggaccctcacggcggctgctgtcagcggggctcagccg
atcctctccaagctggagccccagattgcatcagccagcgaatacgcccacagggggctg
gacaagttggaggagaacctccccatcctgcagcagcccacggagaaggtcctggcggac
accaaggagcttgtgtcgtctaaggtgtcgggggcccaagagatggtgtctagcgccaag
gacacggtggccacccaattgtcggaggcggtggacgcgacccgcggtgctgtgcagagc
ggcgtggacaagacaaagtccgtagtgaccggcggcgtccaatcggtcatgggctcccgc
ttgggccagatggtgttgagtggggtcgacacggtgctggggaagtcggaggagtgggcg
gacaaccacctgccccttacggatgccgaactggcccgcatcgccacatccctggatggc
tttgacgtcgcgtccgtgcagcagcagcggcaggaacagagctacttcgtacgtctgggc
tccctgtcggagaggctgcggcagcacgcctatgagcactcgctgggcaagcttcgagcc
accaagcagagggcacaggaggctctgctgcagctgtcgcaggtcctaagcctgatggaa
actgtcaagcaaggcgttgatcagaagctggtggaaggccaggagaagctgcaccagatg
tggctcagctggaaccagaagcagctccagggccccgagaaggagccgcccaagccagag
caggtcgagtcccgggcgctcaccatgttccgggacattgcccagcaactgcaggccacc
tgtacctccctggggtccagcattcagggcctccccaccaatgtgaaggaccaggtgcag
caggcccgccgccaggtggaggacctccaggccacgttttccagcatccactccttccag
gacctgtccagcagcattctggcccagagccgtgagcgtgtcgccagcgcccgcgaggcc
ctggaccacatggtggaatatgtggcccagaacacacctgtcacgtggctcgtgggaccc
tttgcccctggaatcactgagaaagccccggaggagaagaagtag

DBGET integrated database retrieval system