KEGG   Homo sapiens (human): 10228Help
Entry
10228             CDS       T01001                                 

Gene name
STX6
Definition
(RefSeq) syntaxin 6
  KO
K08498  syntaxin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    10228 (STX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10228 (STX6)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[C] (Qc)
   STX6
    10228 (STX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin-6_N SNARE FliD_C ATPase Pox_EPC_I2-L1 APG17 Spc7
Motif
Other DBs
NCBI-GeneID: 10228
NCBI-ProteinID: NP_005810
OMIM: 603944
HGNC: 11441
Ensembl: ENSG00000135823
Vega: OTTHUMG00000035179
Pharos: O43752(Tbio)
UniProt: O43752
Structure
PDB: 

Position
1q25.3
AA seq 255 aa AA seqDB search
MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWD
LEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTSSVQALAERKNR
QALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSI
GVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAI
LFAVLLVVLILFLVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggaggaccccttctttgtggtgaaaggagaggtacagaaagcagtcaacact
gcccagggattgtttcagagatggacagagctcctccaggacccctccacagcaacaagg
gaagaaatcgactggaccaccaacgagctgagaaataacctccggagcatagagtgggat
ctagaggaccttgatgaaaccatcagcatagttgaagcaaatcctagaaaatttaacctt
gatgcaactgaattgagtataagaaaagccttcattacaagtactcggcaagttgtcagg
gacatgaaagatcagatgtcaacttcatctgtgcaggcattagctgaaagaaaaaataga
caggcactgctgggagacagtggcagccagaactggagcactggaacaacagataaatat
gggcgtctggaccgagagctccagagagccaattctcatttcattgaggagcagcaggca
cagcagcagttgatcgtggaacagcaggatgagcagttggagctggtctctggcagcatc
ggggtgctgaagaacatgtcccagcgcatcggaggggagctggaggaacaggcagttatg
ttggaagatttctctcacgaattggagagcactcagtcccggctggacaatgtgatgaag
aaacttgcaaaagtatctcatatgaccagtgatcggcgccaatggtgtgccatagccatc
ctctttgcagtcctgttggttgtgctcatcctcttcttagtgctgtga

KEGG   Homo sapiens (human): 8677Help
Entry
8677              CDS       T01001                                 

Gene name
STX10, SYN10, hsyn10
Definition
(RefSeq) syntaxin 10
  KO
K23937  syntaxin 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    8677 (STX10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8677 (STX10)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[C] (Qc)
   STX10
    8677 (STX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin-6_N SNARE Ran-binding ATPase
Motif
Other DBs
NCBI-GeneID: 8677
NCBI-ProteinID: NP_003756
OMIM: 603765
HGNC: 11428
Ensembl: ENSG00000104915
Vega: OTTHUMG00000180759
Pharos: O60499(Tbio)
UniProt: O60499
Structure
PDB: 

Position
19p13.13
AA seq 249 aa AA seqDB search
MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWD
LEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNR
EILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHM
SGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLL
LVLILLFSL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgaagaccccttttttgtagtccgaggcgaggtgcagaaggcggtgaacacg
gcccgcgggctgtaccagcgctggtgcgagctcctgcaggaaagcgcggcggtcggacgc
gaggagctggactggacgaccaatgagctgcggaatggcctgcgcagcatcgagtgggac
ctcgaggacctggaagagaccatcggtatagtggaagccaacccaggcaagttcaagctc
ccagccggggacctgcaggagagaaaggtgttcgtggagcggatgcgagaggcagtccag
gaaatgaaggaccatatggtcagcccaacagccgtagcatttttggagaggaataacaga
gagatactcgcaggcaagccagctgcccagaagtcacccagcgacctgctggatgccagc
gcagtctcggccacatctcgctacatcgaggagcagcaggccacacagcagctgatcatg
gatgaacaggatcaacagctggagatggtgtctgggagcatccaggttctgaagcacatg
tccggccgcgttggagaagagctggacgagcagggcatcatgctggatgccttcgcccaa
gagatggaccacacccagtcccgcatggacggggtcctcaggaagttggccaaagtatcc
cacatgacgagtgaccgccgacagtggtgtgccatcgccgtgctagtgggggtgcttctc
ctcgttctcatcttactattctctctctga

DBGET integrated database retrieval system