KEGG   Homo sapiens (human): 10229
Entry
10229             CDS       T01001                                 

Gene name
COQ7, CAT5, CLK-1, CLK1, COQ10D8
Definition
(RefSeq) coenzyme Q7, hydroxylase
  KO
K06134  3-demethoxyubiquinol 3-hydroxylase [EC:1.14.99.60]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00128  Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate + polyprenyl-PP => ubiquinol
Disease
H00999  Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    10229 (COQ7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.60  3-demethoxyubiquinol 3-hydroxylase
     10229 (COQ7)
SSDB
Motif
Pfam: COQ7 Rubrerythrin Glyco_hydro_14
Other DBs
NCBI-GeneID: 10229
NCBI-ProteinID: NP_057222
OMIM: 601683
HGNC: 2244
Ensembl: ENSG00000167186
Vega: OTTHUMG00000131455
Pharos: Q99807(Tbio)
UniProt: Q99807
Position
16p12.3
AA seq 217 aa
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGE
YGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGF
ALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELE
HHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
NT seq 654 nt   +upstreamnt  +downstreamnt
atgagttgcgccggggcggcggcggctccccgcctttggcggctgcgcccgggggcccgg
cggtccctctcagcttatggaagaagaaccagtgtcagatttcgcagttcaggaatgact
ttagacaatatcagtcgggcagctgtggatcgaataatccgggtggatcatgcaggcgaa
tatggagcaaaccgcatctatgccgggcagatggctgtcctgggtcggaccagcgtcggg
ccagtcattcagaaaatgtgggatcaagaaaaggaccatttgaaaaagttcaatgagttg
atggttacgttcagggtccggccaacagttctgatgcccttgtggaacgtgctggggttt
gcactgggggcggggaccgccttgctcgggaaggaaggtgccatggcctgcaccgtggcg
gtggaagagagcatagcacatcactacaacaaccagatcaggacgctgatggaggaggac
cctgaaaaatacgaggaacttcttcagctgataaagaaatttcgggatgaagagcttgag
caccatgacataggcctcgaccatgatgcagaattggctccagcctatgccgtcctgaag
agcattatccaggccggatgcagagtggcgatatatttatcagaaagattataa

DBGET integrated database retrieval system