KEGG   Homo sapiens (human): 10236
Entry
10236             CDS       T01001                                 
Symbol
HNRNPR, HNRPR, hnRNP-R
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein R
  KO
K13161  heterogeneous nuclear ribonucleoprotein R
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10236 (HNRNPR)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   hnRNP proteins
    10236 (HNRNPR)
SSDB
Motif
Pfam: RRM_1 hnRNP_Q_AcD RRM_7 RRM_5 RRM_occluded
Other DBs
NCBI-GeneID: 10236
NCBI-ProteinID: NP_005817
OMIM: 607201
HGNC: 5047
Ensembl: ENSG00000125944
Pharos: O43390(Tbio)
UniProt: O43390
Structure
Position
1:complement(23304688..23344284)
AA seq 633 aa
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDL
DERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTK
GPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDE
LVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVC
ISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHK
SAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKS
FSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYH
DYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPR
GSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIA
QQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggctaatcaggtgaatggtaatgcggtacagttaaaagaagaggaagaaccaatggat
acttccagtgtaactcacacagaacactacaagacactgatagaggcaggcctcccacag
aaggtggcagaaagacttgatgaaatatttcagacaggattggtagcttatgtcgatctt
gatgaaagagcaattgatgctctcagggaatttaatgaagaaggagctctgtctgtacta
cagcagttcaaggaaagtgacttatcacatgttcagaacaaaagtgcatttttatgtgga
gttatgaagacctacaggcagagagagaaacaggggagcaaggtgcaagagtccacaaag
ggacctgatgaagcgaagatcaaggccttgcttgagagaactggttatactctggatgta
accacaggacagaggaagtatggtggtcctccaccagacagtgtgtactctggcgtgcaa
cctggaattggaacggaggtatttgtaggcaaaataccaagggatttatatgaggatgag
ttggtgcccctttttgagaaggccggacccatttgggatctacgtcttatgatggatcca
ctgtccggtcagaatagagggtatgcatttatcaccttctgtggaaaggaagctgcacag
gaagccgtgaaactgtgtgacagctatgaaattcgccctggtaaacaccttggagtgtgc
atttctgtggcaaacaacagactttttgttggatccattccgaagaataagactaaagaa
aacattttggaagaattcagtaaagtcacagagggtttggtggacgttattctctatcat
caacccgatgacaaaaagaagaatcgggggttctgcttccttgaatatgaggatcacaag
tcagcagcacaagccagacgccggctgatgagtggaaaagtaaaagtgtggggaaatgta
gttacagttgaatgggctgaccctgtggaagaaccagatccagaagtcatggctaaggta
aaagttttgtttgtgagaaacttggctactacggtgacagaagaaatattggaaaagtca
ttttctgaatttggaaaactcgaaagagtaaagaagttgaaagattatgcatttgttcat
tttgaagacagaggagcagctgttaaggctatggatgaaatgaatggcaaagaaatagaa
ggggaagaaattgaaatagtcttagccaagccaccagacaagaaaaggaaagagcgccaa
gctgctagacaggcctccagaagcactgcgtatgaagattattactaccaccctcctcct
cgcatgccacctccaattagaggtcggggtcgtggtggggggagaggtggatatggctac
cctccagattactacggctatgaagattactatgatgattactatggttatgattatcac
gactatcgtggaggctatgaagatccctactacggctatgatgatggctatgcagtaaga
ggaagaggaggaggaaggggagggcgaggtgctccaccaccaccaagggggaggggagca
ccacctccaagaggtagagctggctattcacagaggggggcacctttgggaccaccaaga
ggctctaggggtggcagagggggtcctgctcaacagcagagaggccgtggttcccgtgga
tctcggggcaatcgtgggggcaatgtaggaggcaagagaaaggcagatgggtacaaccag
cctgattccaagcgtcgtcagaccaacaaccaacagaactggggttcccaacccatcgct
cagcagccgcttcagcaaggtggtgactattctggtaactatggttacaataatgacaac
caggaattttatcaggatacttatgggcaacagtggaagtag

DBGET integrated database retrieval system