KEGG   Homo sapiens (human): 10239
Entry
10239             CDS       T01001                                 
Symbol
AP3S2, AP3S3, sigma3b
Name
(RefSeq) adaptor related protein complex 3 subunit sigma 2
  KO
K12399  AP-3 complex subunit sigma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    10239 (AP3S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10239 (AP3S2)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    10239 (AP3S2)
 Endosome - Golgi transport
    10239 (AP3S2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 10239
NCBI-ProteinID: NP_005820
OMIM: 602416
HGNC: 571
Ensembl: ENSG00000157823
Pharos: P59780(Tdark)
UniProt: P59780 A0A024RC62
Position
15:complement(89830599..89893994)
AA seq 193 aa
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaacaaccatgggaagccacggctagtccgcttctac
cagcgtttcccagaagaaattcaacagcagattgttcgagagactttccatctagtcctc
aagcgggatgacaacatctgtaacttcttggagggtggaagtttgattggtggctctgac
tacaaactgatctaccggcactatgctaccctctactttgtattttgtgtggattcctca
gagagtgaacttggaatcttggacctcatccaggtttttgtggaaactctggataagtgt
ttcgaaaatgtgtgtgaattggatttgatcttccatatggataaggtgcactacatcctc
caggaggtggtgatgggtgggatggtgttggaaacaaacatgaatgaaatcgtggctcag
attgaggctcaaaacaggctggagaaatccgagggtggcctttcagcagcccctgcgcgg
gctgtgtctgctgtgaaaaacatcaacctgccagagattcctcggaacatcaacattggc
gatctcaacatcaaagttcccaacctgtcccagtttgtctga

DBGET integrated database retrieval system