KEGG   Homo sapiens (human): 1024
Entry
1024              CDS       T01001                                 
Symbol
CDK8, IDDHBA, K35
Name
(RefSeq) cyclin dependent kinase 8
  KO
K02208  cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Disease
H02463  Syndromic intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1024 (CDK8)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    1024 (CDK8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1024 (CDK8)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1024 (CDK8)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1024 (CDK8)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     1024 (CDK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo
Other DBs
NCBI-GeneID: 1024
NCBI-ProteinID: NP_001251
OMIM: 603184
HGNC: 1779
Ensembl: ENSG00000132964
Pharos: P49336(Tchem)
UniProt: P49336
Structure
Position
13:26254129..26405238
AA seq 464 aa
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggactatgactttaaagtgaagctgagcagcgagcgggagcgggtcgaggacctgttt
gaatacgagggctgcaaagttggccgaggcacttatggtcacgtctacaaagccaagagg
aaagatgggaaggatgataaagactatgctttaaaacaaatagaaggaactgggatctct
atgtcggcatgtagagaaatagcattacttcgagagcttaagcatccaaacgtcatttct
cttcaaaaggtgtttctgtctcatgctgataggaaggtgtggcttctgtttgactatgct
gaacatgacctctggcatataatcaagtttcacagagcttctaaagcaaacaagaagcca
gttcagttacctcggggaatggtgaagtcactattatatcagatcctagatggtattcac
tacctgcatgctaactgggtgttgcacagagatttgaaacctgctaatattttagttatg
ggtgaaggtcctgagcgaggaagagtaaaaattgctgacatgggctttgcccgattattt
aattcacctttgaagcctttagcagatttggatccagtggttgttacattctggtaccga
gcccctgaactacttcttggagcaaggcattataccaaagctattgatatttgggctata
gggtgtatatttgcagaactactaacgtcagaaccaatatttcactgtcgacaagaggac
atcaaaactagtaatccttatcaccatgaccagctggacagaatattcaatgtaatggga
tttcctgcagataaagattgggaagatataaaaaagatgcctgaacattcaacattaatg
aaagatttcagaagaaatacgtataccaactgcagccttatcaagtatatggaaaaacat
aaagttaaaccagatagtaaagcattccacttgcttcagaagctgcttaccatggaccca
ataaagcgaattacctcagaacaggctatgcaggacccctatttcttagaagacccactt
cctacatcagacgtttttgccggttgtcaaatcccttacccaaaacgagaatttttaacg
gaagaagaacctgatgacaaaggagacaaaaagaaccagcagcagcagcagggcaataac
cacactaatggaactggccacccagggaatcaagacagcagtcacacacagggacccccg
ttgaagaaagtgagagttgttcctcctaccactacctcaggtggacttatcatgacctca
gactatcagcgttccaatccacatgctgcctatcccaaccctggaccaagcacatcacag
ccgcagagcagcatgggatactcagctacctcccagcagcctccacagtactcacatcag
acacatcggtactga

DBGET integrated database retrieval system