KEGG   Homo sapiens (human): 10242Help
Entry
10242             CDS       T01001                                 

Gene name
KCNMB2
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 2
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    10242 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    10242 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10242 (KCNMB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    10242 (KCNMB2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   10242 (KCNMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB KcnmB2_inactiv AAA_8 tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 10242
NCBI-ProteinID: NP_001265840
OMIM: 605214
HGNC: 6286
Ensembl: ENSG00000197584
Vega: OTTHUMG00000157264
Pharos: Q9Y691(Tbio)
UniProt: Q9Y691 B5BNW5
Position
3q26.32
AA seq 235 aa AA seqDB search
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtttatatggaccagtggccggacctcttcatcttatagacatgatgaaaaaagaaat
atttaccagaaaatcagggaccatgacctcctggacaaaaggaaaacagtcacagcactg
aaggcaggagaggaccgagctattctcctgggactggctatgatggtgtgctccatcatg
atgtattttctgctgggaatcacactcctgcgctcatacatgcagagcgtgtggaccgaa
gagtctcaatgcaccttgctgaatgcgtccatcacggaaacatttaattgctccttcagc
tgtggtccagactgctggaaactttctcagtacccctgcctccaggtgtacgttaacctg
acttcttccggggaaaagctcctcctctaccacacagaagagacaataaaaatcaatcag
aagtgctcctatatacctaaatgtggaaaaaattttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaagtatcaacacttctcctgctattctgacccagaagga
aaccagaagagtgttatcctaacaaaactctacagttccaacgtgctgttccattcactc
ttctggccaacctgtatgatggctgggggtgtggcaattgttgccatggtgaaacttaca
cagtacctctccctactatgtgagaggatccaacggatcaatagataa

DBGET integrated database retrieval system